-- dump date 20250517_150831 -- class Genbank::CDS -- table cds_note -- id note TREMEDRAFT_58011 similar to predicted protein TREMEDRAFT_41409 similar to hypothetical protein CNBG0600 TREMEDRAFT_58013 predicted protein TREMEDRAFT_58014 predicted protein TREMEDRAFT_58016 predicted protein TREMEDRAFT_58018 similar to predicted protein TREMEDRAFT_58019 predicted protein TREMEDRAFT_58020 predicted protein TREMEDRAFT_26182 similar to reverse transcriptase TREMEDRAFT_58024 similar to hypothetical protein CNBM0210 TREMEDRAFT_26133 predicted protein TREMEDRAFT_58027 predicted protein TREMEDRAFT_26069 similar to Putative transposase TREMEDRAFT_58030 predicted protein TREMEDRAFT_58032 predicted protein TREMEDRAFT_58033 predicted protein TREMEDRAFT_58035 predicted protein TREMEDRAFT_58036 predicted protein TREMEDRAFT_58037 predicted protein TREMEDRAFT_58039 predicted protein TREMEDRAFT_24082 similar to hypothetical protein CNBH1390 TREMEDRAFT_66620 similar to hypothetical protein CNBH1380 TREMEDRAFT_58043 predicted protein TREMEDRAFT_58044 similar to hypothetical protein CNBH1350 TREMEDRAFT_58045 predicted protein TREMEDRAFT_58046 predicted protein TREMEDRAFT_25459 similar to predicted protein TREMEDRAFT_66622 similar to hypothetical protein CNBH1330 TREMEDRAFT_25289 similar to hypothetical protein CNBH1320 TREMEDRAFT_26921 similar to hypothetical protein CNBH1480 TREMEDRAFT_26845 similar to hypothetical protein CNBH1490 TREMEDRAFT_58053 predicted protein TREMEDRAFT_58054 predicted protein TREMEDRAFT_58056 predicted protein TREMEDRAFT_58057 predicted protein TREMEDRAFT_26735 similar to hypothetical protein CNBJ1920 TREMEDRAFT_58059 predicted protein TREMEDRAFT_58061 predicted protein TREMEDRAFT_58062 predicted protein TREMEDRAFT_26117 similar to hypothetical protein CNBN1940 TREMEDRAFT_58068 predicted protein TREMEDRAFT_41411 similar to MnSOD; expressed hypothetical protein TREMEDRAFT_55770 expressed protein TREMEDRAFT_41420 similar to hypothetical protein CNBH1180 TREMEDRAFT_72608 expressed protein TREMEDRAFT_58074 similar to conserved hypothetical protein TREMEDRAFT_58075 similar to hypothetical protein MYPE7350 TREMEDRAFT_72610 similar to hypothetical protein CNBH1190 TREMEDRAFT_70589 similar to hypothetical protein CNBH1200 TREMEDRAFT_58079 predicted protein TREMEDRAFT_55774 expressed protein TREMEDRAFT_58084 predicted protein TREMEDRAFT_66633 similar to hypothetical protein TREMEDRAFT_25035 similar to hypothetical protein CNBH1400 TREMEDRAFT_36349 similar to hypothetical protein CNBH1310 TREMEDRAFT_58092 similar to hypothetical protein CC1G_04706 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_24527 similar to f-box protein pof6, putative TREMEDRAFT_26490 similar to hypothetical protein CNBH3670 TREMEDRAFT_26605 similar to hypothetical protein CNBH3590 TREMEDRAFT_41437 similar to response to drug-related protein, putative TREMEDRAFT_24419 similar to hypothetical protein CNBH1880 TREMEDRAFT_72619 similar to aspartate kinase, putative; expressed hypothetical protein TREMEDRAFT_58102 similar to hypothetical protein LOC495999 TREMEDRAFT_66648 similar to hypothetical protein CNBH3550 TREMEDRAFT_55784 expressed protein TREMEDRAFT_58104 similar to hypothetical protein CNBH1860 TREMEDRAFT_70599 similar to vacuolar protein sorting 41, putative TREMEDRAFT_55788 expressed protein TREMEDRAFT_58108 similar to conserved hypothetical protein TREMEDRAFT_58109 predicted protein TREMEDRAFT_58110 predicted protein TREMEDRAFT_58111 predicted protein TREMEDRAFT_58112 predicted protein TREMEDRAFT_58113 similar to hypothetical protein CC1G_09542 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58114 predicted protein TREMEDRAFT_58115 predicted protein TREMEDRAFT_58116 predicted protein TREMEDRAFT_25138 similar to TPA_exp: transposase TREMEDRAFT_58118 predicted protein TREMEDRAFT_58120 predicted protein TREMEDRAFT_58123 predicted protein TREMEDRAFT_58124 predicted protein TREMEDRAFT_55789 expressed protein TREMEDRAFT_58125 predicted protein TREMEDRAFT_58126 predicted protein TREMEDRAFT_55792 expressed protein TREMEDRAFT_26073 similar to conserved hypothetical protein TREMEDRAFT_66656 similar to hypothetical protein CNBH2380 TREMEDRAFT_58130 predicted protein TREMEDRAFT_23406 similar to hypothetical protein TREMEDRAFT_25219 similar to hypothetical protein CNBH2350 TREMEDRAFT_25698 similar to E3 ubiquitin-protein ligase BRE1 TREMEDRAFT_24464 similar to hypothetical protein CNBH2290 TREMEDRAFT_58139 predicted protein TREMEDRAFT_24691 similar to hypothetical protein CNBH2490 TREMEDRAFT_66664 similar to hypothetical protein CNBH2500 TREMEDRAFT_72628 similar to hypothetical protein CNBH2510 TREMEDRAFT_24574 similar to predicted protein TREMEDRAFT_58144 similar to hypothetical protein TREMEDRAFT_26650 similar to hypothetical protein CNBH2550 TREMEDRAFT_58146 similar to mitochondrial ribosomal protein subunit L4 TREMEDRAFT_66667 similar to hypothetical protein CNI02450 TREMEDRAFT_58148 similar to hypothetical protein CNBH2460 TREMEDRAFT_25623 similar to hypothetical protein CNBH2470 TREMEDRAFT_41457 similar to hypothetical protein AN3070.2 TREMEDRAFT_58152 similar to hypothetical protein CNBH2020 TREMEDRAFT_25255 similar to hypothetical protein CNBH2270 TREMEDRAFT_66672 similar to predicted protein TREMEDRAFT_58155 predicted protein TREMEDRAFT_58156 predicted protein TREMEDRAFT_58158 predicted protein TREMEDRAFT_58159 predicted protein TREMEDRAFT_58161 predicted protein TREMEDRAFT_58162 predicted protein TREMEDRAFT_58164 similar to predicted protein TREMEDRAFT_55799 expressed protein TREMEDRAFT_70609 expressed protein TREMEDRAFT_70610 similar to hypothetical protein CNBG0120 TREMEDRAFT_72633 similar to hypothetical protein CNG04620 TREMEDRAFT_58169 similar to gag TREMEDRAFT_58171 predicted protein TREMEDRAFT_58172 predicted protein TREMEDRAFT_25667 similar to hypothetical protein An15g04860 TREMEDRAFT_22252 similar to hypothetical protein CNBG0370 TREMEDRAFT_26165 similar to predicted protein TREMEDRAFT_55800 expressed protein TREMEDRAFT_58178 similar to hypothetical protein CNB00460 TREMEDRAFT_58182 predicted protein TREMEDRAFT_58183 predicted protein TREMEDRAFT_23769 similar to hypothetical protein CNBG0050 TREMEDRAFT_72635 similar to hypothetical protein CNBG0350 TREMEDRAFT_24220 similar to predicted protein TREMEDRAFT_58187 predicted protein TREMEDRAFT_23530 similar to hypothetical protein CNBG0910 TREMEDRAFT_26019 similar to hypothetical protein CNBG0900 TREMEDRAFT_58190 predicted protein TREMEDRAFT_58191 predicted protein TREMEDRAFT_58192 similar to hypothetical protein SS1G_09803 TREMEDRAFT_72637 similar to conserved hypothetical protein TREMEDRAFT_25950 similar to hypothetical protein CNBA0210 TREMEDRAFT_26184 similar to hypothetical protein CNA00020 TREMEDRAFT_58197 similar to allantoate permease TREMEDRAFT_58198 similar to hypothetical protein CNM00640 TREMEDRAFT_70613 similar to Voltage-gated potassium channel beta-2 subunit, putative; expressed hypothetical protein TREMEDRAFT_58200 predicted protein TREMEDRAFT_58201 predicted protein TREMEDRAFT_58203 predicted protein TREMEDRAFT_58204 predicted protein TREMEDRAFT_58206 predicted protein TREMEDRAFT_24432 similar to unnamed protein product TREMEDRAFT_58210 similar to hypothetical protein GFkVgp3 TREMEDRAFT_58212 predicted protein TREMEDRAFT_58213 predicted protein TREMEDRAFT_72640 similar to hypothetical protein CNBH2080 TREMEDRAFT_58215 similar to hypothetical protein CNBH2090 TREMEDRAFT_25026 similar to conserved hypothetical protein TREMEDRAFT_25006 similar to hypothetical protein CNBH3840 TREMEDRAFT_58218 similar to hypothetical protein CNBH3850 TREMEDRAFT_66694 similar to hypothetical protein CNBH2700 TREMEDRAFT_58222 similar to hypothetical protein CNI04100 TREMEDRAFT_26259 similar to mitochondrial genome maintenance protein MGM101 TREMEDRAFT_66697 similar to hypothetical protein CNBH3860 TREMEDRAFT_24410 similar to conserved hypothetical protein TREMEDRAFT_66698 similar to hypothetical protein CNBH3900 TREMEDRAFT_58229 similar to glycosyltransferase, putative TREMEDRAFT_70618 similar to hypothetical protein CNBC2830 TREMEDRAFT_36411 similar to glycosyl-hydrolase, putative; expressed hypothetical protein TREMEDRAFT_58233 predicted protein TREMEDRAFT_26437 similar to hypothetical protein CNBH3470 TREMEDRAFT_26324 similar to predicted protein TREMEDRAFT_26590 similar to hypothetical protein CNBH3450 TREMEDRAFT_66707 similar to hypothetical protein CNBH2000 TREMEDRAFT_26434 similar to hypothetical protein CNBH2060 TREMEDRAFT_24895 similar to hypothetical protein CC1G_03830 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_72651 expressed protein TREMEDRAFT_21025 similar to hypothetical protein CNBH2520 TREMEDRAFT_70623 similar to hypothetical protein CNBH2100 TREMEDRAFT_58246 similar to hypothetical protein CNC00410 TREMEDRAFT_58247 similar to predicted protein TREMEDRAFT_58248 predicted protein TREMEDRAFT_58249 predicted protein TREMEDRAFT_41509 similar to hypothetical protein CNBH3740 TREMEDRAFT_58253 predicted protein TREMEDRAFT_58254 predicted protein TREMEDRAFT_58255 similar to hypothetical protein CIMG_04839 TREMEDRAFT_58257 predicted protein TREMEDRAFT_58258 predicted protein TREMEDRAFT_58259 predicted protein TREMEDRAFT_41513 similar to hypothetical protein CNBH3720 TREMEDRAFT_70627 similar to hypothetical protein CNBH3970 TREMEDRAFT_25666 similar to hypothetical protein CNBH3980 TREMEDRAFT_72658 predicted protein TREMEDRAFT_70628 similar to NAD+ kinase, putative; expressed hypothetical protein TREMEDRAFT_72661 similar to telomeric DNA binding protein, putative TREMEDRAFT_58268 predicted protein TREMEDRAFT_58269 predicted protein TREMEDRAFT_58270 predicted protein TREMEDRAFT_25265 similar to aspartic peptidase A1 TREMEDRAFT_36453 predicted protein TREMEDRAFT_58274 predicted protein TREMEDRAFT_58276 predicted protein TREMEDRAFT_58277 predicted protein TREMEDRAFT_58279 predicted protein TREMEDRAFT_26649 similar to hypothetical protein CNG04580 TREMEDRAFT_25391 similar to hypothetical protein TREMEDRAFT_58282 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58283 similar to hypothetical protein CNG03880 TREMEDRAFT_25467 similar to hypothetical protein CNG03760 TREMEDRAFT_24715 similar to predicted protein TREMEDRAFT_58286 similar to hypothetical protein CNBG1100 TREMEDRAFT_58289 predicted protein TREMEDRAFT_41534 similar to putative alpha-glucan synthase TREMEDRAFT_66724 similar to hypothetical protein CNBG0920 TREMEDRAFT_20901 similar to hypothetical protein CNBM1710 TREMEDRAFT_25160 similar to orotate phosphoribosyltransferase TREMEDRAFT_24336 similar to hypothetical protein CNBG0930 TREMEDRAFT_25563 similar to Histone-lysine N-methyltransferase, H3 lysine-36 specific (SET domain-containing protein 2) TREMEDRAFT_25958 similar to hypothetical protein CNBG0950 TREMEDRAFT_58298 predicted protein TREMEDRAFT_58299 similar to hypothetical protein TREMEDRAFT_58300 predicted protein TREMEDRAFT_36466 similar to ubiquitin carboxyl-terminal hydrolase 12, putative TREMEDRAFT_58302 similar to hypothetical protein CNBG0200 TREMEDRAFT_72668 similar to hypothetical protein CNBG0830 TREMEDRAFT_58304 predicted protein TREMEDRAFT_58305 predicted protein TREMEDRAFT_66731 similar to hypothetical protein CNBG0970 TREMEDRAFT_36469 similar to Glucose-repressible alcohol dehydrogenase transcriptional effector (Cytoplasmic deadenylase) (Carbon catabolite repressor protein 4); expressed hypothetical protein TREMEDRAFT_41543 similar to Glucose-repressible alcohol dehydrogenase transcriptional effector (Cytoplasmic deadenylase) (Carbon catabolite repressor protein 4) TREMEDRAFT_58308 predicted protein TREMEDRAFT_26067 similar to adenylate cyclase, putative TREMEDRAFT_26107 similar to unnamed protein product TREMEDRAFT_58311 similar to Hox5 TREMEDRAFT_22045 similar to conserved hypothetical protein TREMEDRAFT_24583 similar to predicted protein TREMEDRAFT_26442 similar to hypothetical protein CNBK1350 TREMEDRAFT_58315 similar to hypothetical protein CNBG0320 TREMEDRAFT_72670 similar to WD repeat protein, putative TREMEDRAFT_66739 similar to hypothetical protein CNBH1750 TREMEDRAFT_70638 similar to hypothetical protein CNI01890 TREMEDRAFT_58321 predicted protein TREMEDRAFT_58322 predicted protein TREMEDRAFT_58323 predicted protein TREMEDRAFT_58326 similar to hypothetical protein CNBH1420 TREMEDRAFT_66745 similar to hypothetical protein CNBH1440 TREMEDRAFT_70643 similar to hypothetical protein CNBH1460 TREMEDRAFT_58329 similar to hypothetical protein CNBH1470 TREMEDRAFT_58330 predicted protein TREMEDRAFT_58331 predicted protein TREMEDRAFT_41567 similar to hypothetical protein CNBI0140 TREMEDRAFT_58335 similar to hypothetical protein CNL06610 TREMEDRAFT_24726 similar to hypothetical protein CNBH1590 TREMEDRAFT_41579 similar to hypothetical protein CNBH1560 TREMEDRAFT_55843 predicted protein TREMEDRAFT_58345 predicted protein TREMEDRAFT_26944 similar to reverse transcriptase TREMEDRAFT_58349 predicted protein TREMEDRAFT_58350 predicted protein TREMEDRAFT_58351 similar to predicted protein TREMEDRAFT_24030 similar to hypothetical protein CNG04470 TREMEDRAFT_72687 similar to hypothetical protein CNBB3440 TREMEDRAFT_55846 expressed protein TREMEDRAFT_58356 predicted protein TREMEDRAFT_20008 similar to unnamed protein product TREMEDRAFT_66761 similar to hypothetical protein CNBG0440 TREMEDRAFT_24724 similar to hypothetical protein CNBG0430 TREMEDRAFT_21329 similar to hypothetical protein CC1G_00971 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58363 predicted protein TREMEDRAFT_58364 predicted protein TREMEDRAFT_58365 similar to hypothetical protein CNM01700 TREMEDRAFT_25082 similar to hypothetical protein TREMEDRAFT_58369 similar to hypothetical protein CIMG_04839 TREMEDRAFT_58373 predicted protein TREMEDRAFT_58375 predicted protein TREMEDRAFT_66766 similar to MYT1 kinase, putative TREMEDRAFT_70654 similar to hypothetical protein CNBH3310 TREMEDRAFT_58379 similar to hypothetical protein CNBH3690 TREMEDRAFT_23042 similar to hypothetical protein CNBH3430 TREMEDRAFT_58382 similar to peptidylprolyl isomerase A TREMEDRAFT_58384 similar to kinesin K39, putative TREMEDRAFT_58385 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58386 similar to hypothetical protein CNBH3930 TREMEDRAFT_58387 similar to hypothetical protein CNI04020 TREMEDRAFT_25120 similar to hypothetical protein CNBH3950 TREMEDRAFT_20727 similar to hypothetical protein CNBH3660 TREMEDRAFT_58390 similar to hypothetical protein TREMEDRAFT_24881 similar to hypothetical protein CNBH3380 TREMEDRAFT_58392 predicted protein TREMEDRAFT_66776 similar to hypothetical protein BC1G_13452 TREMEDRAFT_26002 similar to hypothetical protein CNBH3280 TREMEDRAFT_24325 similar to hypothetical protein CNBH3500 TREMEDRAFT_58395 similar to predicted protein TREMEDRAFT_72696 similar to hypothetical protein CNBH3820 TREMEDRAFT_58398 similar to hypothetical protein CIMG_04839 TREMEDRAFT_58400 predicted protein TREMEDRAFT_58401 similar to hypothetical protein CNBH3000 TREMEDRAFT_58402 predicted protein TREMEDRAFT_66780 similar to hypothetical protein CNBH3650 TREMEDRAFT_25841 similar to hypothetical protein CNBH3640 TREMEDRAFT_26923 similar to hypothetical protein CNI03810 TREMEDRAFT_21939 similar to predicted protein TREMEDRAFT_17181 similar to hypothetical protein CNBI2420 TREMEDRAFT_70659 similar to hypothetical protein CNBH2750 TREMEDRAFT_58413 similar to hypothetical protein CNBH2900 TREMEDRAFT_58414 predicted protein TREMEDRAFT_58415 similar to hypothetical protein CNBH3110 TREMEDRAFT_58416 similar to hypothetical protein CNI03990 TREMEDRAFT_20116 similar to hypothetical protein CNBH3300 TREMEDRAFT_25509 similar to hypothetical protein CNBH3100 TREMEDRAFT_58418 similar to hypothetical protein CNBK2680 TREMEDRAFT_58419 similar to hypothetical protein CNBK2680 TREMEDRAFT_24812 similar to hypothetical protein CNI03210 TREMEDRAFT_26372 similar to hypothetical protein CNBH3150 TREMEDRAFT_70660 similar to hypothetical protein CNBH3160 TREMEDRAFT_58425 predicted protein TREMEDRAFT_24060 similar to predicted protein TREMEDRAFT_58429 similar to hypothetical protein CNBH3020 TREMEDRAFT_72706 similar to hypothetical protein CNBH3260 TREMEDRAFT_58432 predicted protein TREMEDRAFT_58433 predicted protein TREMEDRAFT_58434 similar to hypothetical protein CNBH3250 TREMEDRAFT_70665 similar to conserved hypothetical protein TREMEDRAFT_58436 similar to hypothetical protein CNBH3230 TREMEDRAFT_58438 predicted protein TREMEDRAFT_58439 predicted protein TREMEDRAFT_24538 similar to mitogen activated protein kinase TREMEDRAFT_36553 similar to DNA repair protein rad16, putative TREMEDRAFT_55864 expressed protein TREMEDRAFT_58446 similar to hypothetical protein TREMEDRAFT_22970 similar to hypothetical protein CNBE0540 TREMEDRAFT_20593 similar to hypothetical protein CNBE0350 TREMEDRAFT_58450 similar to hypothetical protein CNBE0340 TREMEDRAFT_25191 similar to hypothetical protein CNBE0670 TREMEDRAFT_58452 predicted protein TREMEDRAFT_58453 predicted protein TREMEDRAFT_58455 predicted protein TREMEDRAFT_58456 predicted protein TREMEDRAFT_58457 predicted protein TREMEDRAFT_58460 similar to hypothetical protein CNBE0660 TREMEDRAFT_72714 related to Mre11 TREMEDRAFT_66806 similar to hypothetical protein CNBE0630 TREMEDRAFT_25176 similar to hypothetical protein CNBE0710 TREMEDRAFT_58465 predicted protein TREMEDRAFT_25247 similar to hypothetical protein CNBE0580 TREMEDRAFT_70672 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_41638 similar to KEX1 protein precursor, putative; expressed hypothetical protein TREMEDRAFT_58469 predicted protein TREMEDRAFT_24620 similar to conserved hypothetical protein TREMEDRAFT_58473 predicted protein TREMEDRAFT_58474 predicted protein TREMEDRAFT_26847 similar to conserved hypothetical protein TREMEDRAFT_70674 similar to hypothetical protein CNE00290 TREMEDRAFT_66816 similar to hypothetical protein CNBE0130 TREMEDRAFT_58482 similar to hypothetical protein CNBE0140 TREMEDRAFT_14118 similar to hypothetical protein CNBE0420 TREMEDRAFT_58484 similar to hypothetical protein CNE00360 TREMEDRAFT_58485 similar to hypothetical protein CNBE0100 TREMEDRAFT_55881 predicted protein TREMEDRAFT_58487 predicted protein TREMEDRAFT_58488 predicted protein TREMEDRAFT_25239 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_58490 similar to hypothetical protein TREMEDRAFT_58491 predicted protein TREMEDRAFT_41658 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_58495 predicted protein TREMEDRAFT_58496 similar to hypothetical protein TREMEDRAFT_58497 predicted protein TREMEDRAFT_58499 predicted protein TREMEDRAFT_21790 similar to conserved hypothetical protein TREMEDRAFT_26128 similar to hypothetical protein CNBA7920 TREMEDRAFT_66830 similar to hypothetical protein CNBE0250 TREMEDRAFT_24694 similar to hypothetical protein CNBB0670 TREMEDRAFT_41668 similar to hypothetical protein MGG_03869 TREMEDRAFT_26471 similar to hypothetical protein CNM02480 TREMEDRAFT_55892 expressed protein TREMEDRAFT_70691 expressed protein TREMEDRAFT_58513 predicted protein TREMEDRAFT_58514 predicted protein TREMEDRAFT_58515 predicted protein TREMEDRAFT_26101 similar to hypothetical protein CNBC4420 TREMEDRAFT_55897 predicted protein TREMEDRAFT_58525 predicted protein TREMEDRAFT_58526 predicted protein TREMEDRAFT_25821 similar to Drp1p; expressed hypothetical protein TREMEDRAFT_41693 similar to hypothetical protein CNM01110 TREMEDRAFT_58530 similar to SJCHGC05331 protein TREMEDRAFT_66847 similar to hypothetical protein CNBM2070 TREMEDRAFT_72742 similar to hypothetical protein CNM02280 TREMEDRAFT_58534 similar to predicted protein TREMEDRAFT_58535 predicted protein TREMEDRAFT_66851 similar to hypothetical protein CNM01850 TREMEDRAFT_66853 similar to hypothetical protein CNM02260 TREMEDRAFT_55907 expressed protein TREMEDRAFT_58541 predicted protein TREMEDRAFT_25849 similar to hypothetical protein CNM01330 TREMEDRAFT_26582 similar to hypothetical protein CNBM1090 TREMEDRAFT_70705 similar to hypothetical protein CNM01240 TREMEDRAFT_26732 similar to predicted protein TREMEDRAFT_25430 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_26535 similar to hypothetical protein CNBM1220 TREMEDRAFT_10950 similar to signal transducer, putative TREMEDRAFT_58553 predicted protein TREMEDRAFT_58554 predicted protein TREMEDRAFT_58555 predicted protein TREMEDRAFT_26078 similar to putative reverse transcriptase-RNaseH-integrase TREMEDRAFT_26851 similar to hypothetical protein CNM02180 TREMEDRAFT_19024 similar to hypothetical protein CNBM1880 TREMEDRAFT_72754 predicted protein TREMEDRAFT_25177 similar to hypothetical protein CNM02160 TREMEDRAFT_66871 similar to hypothetical protein CNM02200 TREMEDRAFT_58562 predicted protein TREMEDRAFT_66873 similar to hypothetical protein CNBM0990 TREMEDRAFT_24290 similar to hypothetical protein CNM01210 TREMEDRAFT_66876 similar to hypothetical protein CNM01310 TREMEDRAFT_58570 similar to hypothetical protein CC1G_12373 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58571 similar to hypothetical protein TREMEDRAFT_58575 similar to hypothetical protein MGG_09044 TREMEDRAFT_58576 predicted protein TREMEDRAFT_36687 similar to hypothetical protein UM01920.1; expressed hypothetical protein TREMEDRAFT_58578 similar to hypothetical protein, partial TREMEDRAFT_58579 predicted protein TREMEDRAFT_58581 predicted protein TREMEDRAFT_58583 similar to hypothetical protein CNBC3930 TREMEDRAFT_26105 similar to hypothetical protein CNBC3920 TREMEDRAFT_26882 similar to unnamed protein product TREMEDRAFT_58586 predicted protein TREMEDRAFT_58587 similar to hypothetical protein TREMEDRAFT_26115 similar to hypothetical protein CC1G_12806 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58588 predicted protein TREMEDRAFT_58589 predicted protein TREMEDRAFT_58590 predicted protein TREMEDRAFT_58591 predicted protein TREMEDRAFT_58592 predicted protein TREMEDRAFT_58593 predicted protein TREMEDRAFT_58594 predicted protein TREMEDRAFT_66886 similar to peroxisomal membrane protein pex13 (peroxin-13), putative TREMEDRAFT_58597 similar to hypothetical protein CNBC5050 TREMEDRAFT_58598 similar to hypothetical protein CNBC4710 TREMEDRAFT_41754 Probable beta-glucosidase TREMEDRAFT_66889 similar to conserved hypothetical protein TREMEDRAFT_58601 similar to ER-associated protein catabolism-related protein, putative TREMEDRAFT_25063 similar to hypothetical protein CNBC4790 TREMEDRAFT_16454 similar to unnamed protein product TREMEDRAFT_58604 predicted protein TREMEDRAFT_58605 predicted protein TREMEDRAFT_58606 similar to hypothetical protein CNB00460 TREMEDRAFT_58608 similar to predicted protein TREMEDRAFT_58610 predicted protein TREMEDRAFT_58611 predicted protein TREMEDRAFT_26942 similar to putative reverse transcriptase-RNaseH-integrase TREMEDRAFT_58614 predicted protein TREMEDRAFT_58615 predicted protein TREMEDRAFT_41756 similar to alpha-1,6-mannosyltransferase, putative; expressed hypothetical protein TREMEDRAFT_18058 similar to hypothetical protein CNBC3830 TREMEDRAFT_25756 similar to hypothetical protein CNC03560 TREMEDRAFT_58619 similar to hypothetical protein TREMEDRAFT_66895 similar to Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate isomerase) (GNPDA) (GlcN6P deaminase) TREMEDRAFT_25144 similar to DNAj protein, putative TREMEDRAFT_58621 similar to GA14308-PA TREMEDRAFT_58623 predicted protein TREMEDRAFT_58624 similar to predicted protein TREMEDRAFT_70724 similar to conserved hypothetical protein TREMEDRAFT_36716 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_72771 expressed protein TREMEDRAFT_58628 predicted protein TREMEDRAFT_58629 predicted protein TREMEDRAFT_58630 predicted protein TREMEDRAFT_58635 predicted protein TREMEDRAFT_58638 predicted protein TREMEDRAFT_58639 predicted protein TREMEDRAFT_58640 predicted protein TREMEDRAFT_26072 similar to gag-pol polyprotein TREMEDRAFT_58643 predicted protein TREMEDRAFT_58644 predicted protein TREMEDRAFT_55941 similar to glucosyltransferase TREMEDRAFT_55942 expressed protein TREMEDRAFT_58647 similar to unnamed protein product TREMEDRAFT_58649 predicted protein TREMEDRAFT_66902 similar to conserved hypothetical protein TREMEDRAFT_41773 similar to GTP-binding protein, putative TREMEDRAFT_25688 similar to predicted protein TREMEDRAFT_72775 similar to conserved hypothetical protein TREMEDRAFT_58654 similar to hypothetical protein CNBC5100 TREMEDRAFT_25871 similar to hypothetical protein CNBM1400 TREMEDRAFT_25574 similar to hypothetical protein CNM01620 TREMEDRAFT_66911 similar to hypothetical protein CNM01480 TREMEDRAFT_26898 similar to hypothetical protein CNM01450 TREMEDRAFT_58668 predicted protein TREMEDRAFT_41792 similar to mitochondrial inner membrane protein, putative; expressed hypothetical protein TREMEDRAFT_17826 similar to Protein FDD123 (CvHSP30/1) TREMEDRAFT_24778 similar to hypothetical protein CNB05240 TREMEDRAFT_58672 similar to hypothetical protein NCU07064 TREMEDRAFT_26203 similar to hypothetical protein An11g03620 TREMEDRAFT_24787 similar to MFS sugar transporter, putative TREMEDRAFT_26413 similar to predicted protein TREMEDRAFT_58676 similar to hypothetical protein CNBC4440 TREMEDRAFT_24609 similar to hypothetical protein CNM00390 TREMEDRAFT_41797 similar to dUTP diphosphatase, putative; expressed hypothetical protein TREMEDRAFT_66921 similar to hypothetical protein CNBM1300 TREMEDRAFT_66924 similar to hypothetical protein CNBC4460 TREMEDRAFT_58684 similar to hypothetical protein CNBH2730 TREMEDRAFT_58685 similar to hypothetical protein TREMEDRAFT_26125 similar to hypothetical protein CNBA4930 TREMEDRAFT_66926 similar to hypothetical protein ATEG_06620 TREMEDRAFT_66927 similar to hydrolase, putative TREMEDRAFT_26769 similar to hypothetical protein TREMEDRAFT_66929 similar to hypothetical protein CNM02370 TREMEDRAFT_26302 similar to alpha-1,2-mannosidase, putative TREMEDRAFT_26263 similar to hypothetical protein SS1G_01096 TREMEDRAFT_26956 similar to hypothetical protein CNBC4510 TREMEDRAFT_58701 similar to hypothetical protein CNC02550 TREMEDRAFT_58702 similar to hypothetical protein CNBC3030 TREMEDRAFT_58704 predicted protein TREMEDRAFT_58705 predicted protein TREMEDRAFT_58706 predicted protein TREMEDRAFT_26050 similar to hypothetical protein CNBH1250 TREMEDRAFT_58708 similar to hypothetical protein SNOG_09736 TREMEDRAFT_58709 predicted protein TREMEDRAFT_58710 predicted protein TREMEDRAFT_58711 predicted protein TREMEDRAFT_26823 similar to hypothetical protein CC1G_06731 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58713 similar to hypothetical protein CNM01940 TREMEDRAFT_70746 similar to RTA1 domain protein; expressed hypothetical protein TREMEDRAFT_25231 similar to hypothetical protein CNM01990 TREMEDRAFT_70747 similar to hypothetical protein CNM01980 TREMEDRAFT_23904 similar to hypothetical protein CNM01400 TREMEDRAFT_58720 predicted protein TREMEDRAFT_72800 similar to endoplasmic reticulum receptor, putative; expressed hypothetical protein TREMEDRAFT_66940 similar to hypothetical protein CNBM1600 TREMEDRAFT_58723 predicted protein TREMEDRAFT_58724 similar to hypothetical protein CNBC4560 TREMEDRAFT_55968 expressed protein TREMEDRAFT_25303 similar to riboflavin aldehyde-forming enzyme; expressed hypothetical protein TREMEDRAFT_18134 similar to pig-L TREMEDRAFT_58729 predicted protein TREMEDRAFT_58731 predicted protein TREMEDRAFT_58732 predicted protein TREMEDRAFT_58733 predicted protein TREMEDRAFT_58734 similar to hypothetical protein CNM01860 TREMEDRAFT_55970 expressed protein TREMEDRAFT_25947 similar to predicted protein TREMEDRAFT_25829 similar to hypothetical protein CNM01900 TREMEDRAFT_58737 similar to hypothetical protein CNM01880 TREMEDRAFT_58738 predicted protein TREMEDRAFT_72807 similar to ATP-dependent RNA helicase DBP9; expressed hypothetical protein TREMEDRAFT_36788 similar to hypothetical protein CNM01040 TREMEDRAFT_72809 similar to hypothetical protein CNBM1250 TREMEDRAFT_58742 similar to hypothetical protein CNBM2050 TREMEDRAFT_24880 similar to hypothetical protein CNM02150 TREMEDRAFT_72810 predicted protein TREMEDRAFT_66953 similar to hypothetical protein CNBM1050 TREMEDRAFT_25132 similar to predicted protein TREMEDRAFT_58747 similar to hypothetical protein CNM02120 TREMEDRAFT_58748 predicted protein TREMEDRAFT_58749 predicted protein TREMEDRAFT_58750 predicted protein TREMEDRAFT_58751 predicted protein TREMEDRAFT_58753 similar to hypothetical protein CIMG_04839 TREMEDRAFT_58755 predicted protein TREMEDRAFT_58756 similar to hypothetical protein CNM01510 TREMEDRAFT_26479 similar to hypothetical protein CNBM1390 TREMEDRAFT_25151 similar to hypothetical protein CNBM1420 TREMEDRAFT_58760 predicted protein TREMEDRAFT_58761 predicted protein TREMEDRAFT_58763 similar to hypothetical protein CNM01630 TREMEDRAFT_58764 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_41848 similar to importin-alpha export receptor, putative TREMEDRAFT_58766 predicted protein TREMEDRAFT_58767 predicted protein TREMEDRAFT_58768 predicted protein TREMEDRAFT_58769 predicted protein TREMEDRAFT_58770 predicted protein TREMEDRAFT_12051 similar to hypothetical protein CNBJ2880 TREMEDRAFT_26939 similar to hypothetical protein CNBC3960 TREMEDRAFT_25018 similar to predicted protein TREMEDRAFT_24317 similar to hypothetical protein CNK00340 TREMEDRAFT_25419 similar to hypothetical protein An12g01570 TREMEDRAFT_58779 similar to conserved hypothetical protein TREMEDRAFT_58780 predicted protein TREMEDRAFT_70764 similar to hypothetical protein CNC05030 TREMEDRAFT_19366 similar to chaperone protein DNAJ, putative TREMEDRAFT_58784 similar to unnamed protein product TREMEDRAFT_58785 similar to tropomyosin4-2 TREMEDRAFT_12876 similar to ferric-chelate reductase, putative TREMEDRAFT_58788 predicted protein TREMEDRAFT_58789 predicted protein TREMEDRAFT_58790 predicted protein TREMEDRAFT_58791 predicted protein TREMEDRAFT_58792 predicted protein TREMEDRAFT_72822 expressed protein TREMEDRAFT_58794 predicted protein TREMEDRAFT_26914 similar to hypothetical protein CNC04970 TREMEDRAFT_36815 similar to CAP64 gene product; expressed hypothetical protein TREMEDRAFT_36819 similar to Probable proteasome subunit beta type-2; expressed hypothetical protein TREMEDRAFT_41874 similar to hypothetical protein CNBC2160 TREMEDRAFT_58800 predicted protein TREMEDRAFT_70770 similar to hypothetical protein CNBC1760 TREMEDRAFT_58802 predicted protein TREMEDRAFT_36825 similar to hypothetical protein CNBC3280 TREMEDRAFT_21878 similar to hypothetical protein UM00846.1 TREMEDRAFT_58805 similar to hypothetical protein CNBC3290 TREMEDRAFT_58806 predicted protein TREMEDRAFT_72829 similar to hypothetical protein CNC05390 TREMEDRAFT_70773 similar to hypothetical protein CNBC2100 TREMEDRAFT_25654 similar to hypothetical protein CNBC2650 TREMEDRAFT_25545 similar to predicted protein TREMEDRAFT_66980 similar to hypothetical protein FG07707.1; expressed hypothetical protein TREMEDRAFT_72833 similar to hypothetical protein CNBB4180 TREMEDRAFT_58815 predicted protein TREMEDRAFT_58816 predicted protein TREMEDRAFT_58817 predicted protein TREMEDRAFT_58821 predicted protein TREMEDRAFT_58822 similar to hypothetical protein TREMEDRAFT_25761 similar to hypothetical protein CNC04920 TREMEDRAFT_36843 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_58826 similar to predicted protein TREMEDRAFT_58827 similar to hypothetical protein CIMG_04839 TREMEDRAFT_58829 predicted protein TREMEDRAFT_58831 predicted protein TREMEDRAFT_25705 similar to hypothetical protein CNBC2500 TREMEDRAFT_58833 predicted protein TREMEDRAFT_58834 predicted protein TREMEDRAFT_58835 predicted protein TREMEDRAFT_58836 similar to predicted protein TREMEDRAFT_58837 predicted protein TREMEDRAFT_58838 similar to hypothetical protein CIMG_04839 TREMEDRAFT_58841 predicted protein TREMEDRAFT_25408 similar to hypothetical protein TREMEDRAFT_24569 similar to transcription initiation factor tfiid 111 kda subunit, putative TREMEDRAFT_41904 similar to Sterol 3-beta-glucosyltransferase (Autophagy-related protein 26) TREMEDRAFT_66993 similar to endopeptidase, putative TREMEDRAFT_58846 similar to proteophosphoglycan ppg4 [Leishmania braziliensis MHOM/BR/75/M2904] TREMEDRAFT_24772 RecQ helicase family, related to Sgs1 TREMEDRAFT_24263 similar to hypothetical protein CNBC2770 TREMEDRAFT_58849 predicted protein TREMEDRAFT_72843 similar to amino-acid N-acetyltransferase, putative TREMEDRAFT_58852 predicted protein TREMEDRAFT_25347 similar to conserved hypothetical protein TREMEDRAFT_72846 similar to hypothetical protein CNBC2900 TREMEDRAFT_70788 similar to glycerol-3-phosphate dehydrogenase, putative; expressed hypothetical protein TREMEDRAFT_58857 predicted protein TREMEDRAFT_58858 predicted protein TREMEDRAFT_70789 similar to hypothetical protein CNBC2850 TREMEDRAFT_67004 similar to hypothetical protein BC1G_06968 TREMEDRAFT_56000 expressed protein TREMEDRAFT_70790 expressed protein TREMEDRAFT_41927 similar to hypothetical protein CNC04270 TREMEDRAFT_25891 similar to hypothetical protein CNBC6720 TREMEDRAFT_58866 predicted protein TREMEDRAFT_26773 similar to hypothetical protein CNBC6690 TREMEDRAFT_11924 similar to hypothetical protein CNBC6740 TREMEDRAFT_72853 expressed protein TREMEDRAFT_19744 similar to hypothetical protein CNBC6900 TREMEDRAFT_25723 similar to hypothetical protein CNBC2310 TREMEDRAFT_58873 predicted protein TREMEDRAFT_58875 predicted protein TREMEDRAFT_58876 predicted protein TREMEDRAFT_58877 predicted protein TREMEDRAFT_58878 similar to hypothetical protein CNBC6800 TREMEDRAFT_24629 similar to hypothetical protein CNBC1700 TREMEDRAFT_25343 similar to hypothetical protein CNBC1690 TREMEDRAFT_25423 similar to hypothetical protein CNBC1220 TREMEDRAFT_36890 similar to tryptophanyl-tRNA synthetase, putative; expressed hypothetical protein TREMEDRAFT_24631 similar to 3'-5' TREMEDRAFT_13947 similar to hypothetical protein CNBC6660 TREMEDRAFT_26719 similar to conserved hypothetical protein TREMEDRAFT_70798 similar to hypothetical protein CNBC1610 TREMEDRAFT_67022 similar to hypothetical protein CNBC1580 TREMEDRAFT_58890 similar to hypothetical protein TREMEDRAFT_58891 similar to CT099 TREMEDRAFT_67023 similar to hypothetical protein CNC05610 TREMEDRAFT_58893 predicted protein TREMEDRAFT_67024 similar to hypothetical protein CNBC1230 TREMEDRAFT_58895 predicted protein TREMEDRAFT_25539 similar to nuclear mRNA splicing protein TREMEDRAFT_58897 predicted protein TREMEDRAFT_41946 similar to thioredoxin, putative; expressed hypothetical protein TREMEDRAFT_72862 similar to hypothetical protein CNBC1720 TREMEDRAFT_67030 similar to hypothetical protein CNBC1290 TREMEDRAFT_25984 similar to hypothetical protein CNBC1520 TREMEDRAFT_25323 similar to predicted protein TREMEDRAFT_26275 similar to hypothetical protein CNBC1450 TREMEDRAFT_67034 similar to hypothetical protein CNBC1430 TREMEDRAFT_16349 similar to hypothetical protein CNBC1440 TREMEDRAFT_67036 similar to hypothetical protein CNBC1540 TREMEDRAFT_67037 similar to hypothetical protein CNBC1530 TREMEDRAFT_22411 similar to predicted protein TREMEDRAFT_58911 predicted protein TREMEDRAFT_58912 similar to hypothetical protein CNBC1410 TREMEDRAFT_25826 similar to hypothetical protein CNBC1400 TREMEDRAFT_58914 predicted protein TREMEDRAFT_24503 similar to predicted protein TREMEDRAFT_67038 similar to conserved hypothetical protein TREMEDRAFT_58917 similar to unnamed protein product TREMEDRAFT_25597 similar to hypothetical protein CNBC3320 TREMEDRAFT_58919 predicted protein TREMEDRAFT_58920 similar to predicted protein TREMEDRAFT_58921 predicted protein TREMEDRAFT_58922 predicted protein TREMEDRAFT_58924 predicted protein TREMEDRAFT_58925 predicted protein TREMEDRAFT_58928 similar to hypothetical protein CNBC3300 TREMEDRAFT_72866 similar to hypothetical protein CNBC1380 TREMEDRAFT_41962 similar to hypothetical protein CNBC4950 TREMEDRAFT_24487 similar to hypothetical protein CNBC4740 TREMEDRAFT_24699 similar to hypothetical protein TREMEDRAFT_25944 similar to hypothetical protein TREMEDRAFT_15236 similar to hydroxymethylbilane synthase, putative; expressed hypothetical protein TREMEDRAFT_26328 similar to hypothetical protein CNBC3860 TREMEDRAFT_58941 predicted protein TREMEDRAFT_58942 predicted protein TREMEDRAFT_41970 similar to hypothetical protein CNBC3640 TREMEDRAFT_72876 similar to hypothetical protein CNBC3780 TREMEDRAFT_58947 predicted protein TREMEDRAFT_26330 similar to predicted protein TREMEDRAFT_67052 similar to hypothetical protein CNC02570 TREMEDRAFT_25428 similar to hypothetical protein CNBC5030 TREMEDRAFT_58952 similar to hypothetical protein CNBM1510 TREMEDRAFT_26879 similar to Ste7 TREMEDRAFT_58954 predicted protein TREMEDRAFT_58955 predicted protein TREMEDRAFT_58956 similar to hypothetical protein CNC02200 TREMEDRAFT_58958 similar to hypothetical protein TREMEDRAFT_15960 similar to hypothetical protein TREMEDRAFT_24652 similar to hypothetical protein CNBC4980 TREMEDRAFT_25851 similar to hypothetical protein CNBC4660 TREMEDRAFT_67058 similar to hypothetical protein CNC02420 TREMEDRAFT_24523 similar to hypothetical protein CNBC4910 TREMEDRAFT_25751 similar to hypothetical protein CNBC4640 TREMEDRAFT_70810 similar to glycerol-3-phosphate O-acyltransferase, putative; expressed hypothetical protein TREMEDRAFT_67061 similar to nuclear matrix protein NMP200, putative TREMEDRAFT_58968 similar to hypothetical protein CNBC4840 TREMEDRAFT_25119 similar to ATPase, putative TREMEDRAFT_25213 similar to predicted protein TREMEDRAFT_58971 predicted protein TREMEDRAFT_72882 similar to predicted protein TREMEDRAFT_14082 similar to FACT complex subunit SPT16 (Facilitates chromatin transcription complex subunit SPT16) TREMEDRAFT_25659 similar to hypothetical protein CNBC4960 TREMEDRAFT_25165 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_58976 similar to conserved hypothetical protein TREMEDRAFT_72886 similar to hypothetical protein CNBC3880 TREMEDRAFT_72890 expressed protein TREMEDRAFT_58982 similar to hypothetical protein CNI02910 TREMEDRAFT_72891 similar to hypothetical protein CNC02360 TREMEDRAFT_70822 similar to hypothetical protein CNBC3240 TREMEDRAFT_58985 predicted protein TREMEDRAFT_25833 similar to hypothetical protein CNBC2590 TREMEDRAFT_58987 similar to hypothetical protein CNBC6610 TREMEDRAFT_58988 predicted protein TREMEDRAFT_58989 predicted protein TREMEDRAFT_58990 predicted protein TREMEDRAFT_25150 similar to hypothetical protein CNBC6630 TREMEDRAFT_58992 predicted protein TREMEDRAFT_42004 similar to hypothetical protein CNBC1130 TREMEDRAFT_72894 similar to protein kinase, putative TREMEDRAFT_24798 similar to hypothetical protein CNBC1330 TREMEDRAFT_72897 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_26575 similar to hypothetical protein CNBC1070 TREMEDRAFT_42014 similar to hypothetical protein CNBC6510 TREMEDRAFT_67088 similar to hypothetical protein CNBC1000 TREMEDRAFT_26656 similar to hypothetical protein CNBC6570 TREMEDRAFT_70830 expressed protein TREMEDRAFT_59007 predicted protein TREMEDRAFT_59008 similar to hypothetical protein CNBC1310 TREMEDRAFT_24963 similar to hypothetical protein CNC05880 TREMEDRAFT_25743 similar to hypothetical protein CNBC1090 TREMEDRAFT_24796 similar to hypothetical protein CNBC6530 TREMEDRAFT_67095 similar to hypothetical protein CNBC6550 TREMEDRAFT_12890 similar to hypothetical protein CNC00680 TREMEDRAFT_18225 similar to hypothetical protein Kpol_499p8 TREMEDRAFT_59017 similar to hypothetical protein CNBC1030 TREMEDRAFT_59018 similar to hypothetical protein CNC06190 TREMEDRAFT_59021 predicted protein TREMEDRAFT_59022 similar to hypothetical protein CNBC1200 TREMEDRAFT_20784 similar to hypothetical protein CNC05970 TREMEDRAFT_42032 similar to hypothetical protein CNC05310 TREMEDRAFT_59026 similar to predicted protein TREMEDRAFT_24079 similar to hypothetical protein An09g00630 TREMEDRAFT_25739 similar to hypothetical protein CC1G_07724 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_37000 similar to phenylalanyl-tRNA synthetase beta chain, putative; expressed hypothetical protein TREMEDRAFT_25124 similar to hypothetical protein TREMEDRAFT_59033 similar to hypothetical protein CNC05550 TREMEDRAFT_42047 similar to hypothetical protein CNBC1680 TREMEDRAFT_59035 similar to predicted protein TREMEDRAFT_42049 similar to hypothetical protein CNBC1320 TREMEDRAFT_59037 predicted protein TREMEDRAFT_56061 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_26937 similar to protein disulfide isomerase, putative TREMEDRAFT_59040 predicted protein TREMEDRAFT_67113 similar to hypothetical protein UM01126.1 TREMEDRAFT_72916 predicted protein TREMEDRAFT_59045 predicted protein TREMEDRAFT_24586 similar to glycine rich protein, putative TREMEDRAFT_59047 similar to hypothetical protein CNBC2040 TREMEDRAFT_59048 similar to hypothetical protein CNBC2030 TREMEDRAFT_56065 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_59050 similar to tRNA (guanine-N(1)-)-methyltransferase (tRNA methyltransferase 10) TREMEDRAFT_59051 predicted protein TREMEDRAFT_59052 similar to hypothetical protein CNBC1280 TREMEDRAFT_59055 predicted protein TREMEDRAFT_25312 similar to The Crystal Structure Of The Exon Junction Complex TREMEDRAFT_59057 similar to hypothetical protein CNBC6970 TREMEDRAFT_70849 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_59059 similar to CG10910 CG10910-PB TREMEDRAFT_56071 similar to hypothetical protein CNBC7060 TREMEDRAFT_26114 similar to hypothetical protein CNBC1990 TREMEDRAFT_67125 similar to hypothetical protein CNC05210 TREMEDRAFT_72922 similar to hypothetical protein CNBC1950 TREMEDRAFT_70851 similar to d-arabinitol 2-dehydrogenase, putative; expressed hypothetical protein TREMEDRAFT_70852 expressed protein TREMEDRAFT_59070 predicted protein TREMEDRAFT_59071 similar to hypothetical protein TREMEDRAFT_15744 similar to hypothetical protein CNBC1940 TREMEDRAFT_59073 similar to hypothetical protein CNBC1620 TREMEDRAFT_59074 predicted protein TREMEDRAFT_59078 predicted protein TREMEDRAFT_59079 predicted protein TREMEDRAFT_59080 similar to hypothetical protein TREMEDRAFT_59082 similar to hypothetical protein CNBA3840 TREMEDRAFT_70859 similar to hypothetical protein CNBA4210 TREMEDRAFT_59084 similar to hypothetical protein CNBA4220 TREMEDRAFT_59085 predicted protein TREMEDRAFT_59087 similar to hypothetical protein CNBA4340 TREMEDRAFT_59089 similar to M protein TREMEDRAFT_59090 predicted protein TREMEDRAFT_67140 similar to hypothetical protein CNBA4320 TREMEDRAFT_67141 similar to predicted protein TREMEDRAFT_20279 similar to hypothetical protein CNBA4280 TREMEDRAFT_25672 similar to hypothetical protein CNBA4290 TREMEDRAFT_59094 predicted protein TREMEDRAFT_72936 predicted protein TREMEDRAFT_15851 similar to hypothetical protein CNBA4510 TREMEDRAFT_59098 predicted protein TREMEDRAFT_59099 predicted protein TREMEDRAFT_59100 predicted protein TREMEDRAFT_70863 similar to hypothetical protein CNA04010 TREMEDRAFT_59103 predicted protein TREMEDRAFT_59104 predicted protein TREMEDRAFT_25037 similar to hypothetical protein CNBI3000 TREMEDRAFT_37064 similar to hypothetical protein CNBI2990 TREMEDRAFT_59107 predicted protein TREMEDRAFT_59108 predicted protein TREMEDRAFT_42106 similar to hypothetical protein CNBA3810 TREMEDRAFT_59110 similar to hypothetical protein CNBA4480 TREMEDRAFT_56089 expressed protein TREMEDRAFT_72942 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_56092 expressed protein TREMEDRAFT_59115 similar to hypothetical protein CNBA5070 TREMEDRAFT_24256 similar to hypothetical protein CNBA4380 TREMEDRAFT_56093 similar to hypothetical protein FG07784.1; expressed hypothetical protein TREMEDRAFT_70870 expressed protein TREMEDRAFT_42115 similar to Peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) (Rotamase); expressed hypothetical protein TREMEDRAFT_59120 similar to hypothetical protein TREMEDRAFT_59121 similar to hypothetical protein CNBA4580 TREMEDRAFT_26589 similar to hypothetical protein CNBA4590 TREMEDRAFT_26118 similar to retrotransposon nucleocapsid protein, putative TREMEDRAFT_59128 predicted protein TREMEDRAFT_59130 predicted protein TREMEDRAFT_42124 similar to Structure Of The H3-H4 Chaperone Asf1 Bound To Histones H3 And H4; expressed hypothetical protein TREMEDRAFT_67163 similar to hypothetical protein CNBA4920 TREMEDRAFT_59136 similar to hypothetical protein DDBDRAFT_0217482 TREMEDRAFT_24786 similar to predicted protein TREMEDRAFT_59138 predicted protein TREMEDRAFT_59139 similar to predicted protein TREMEDRAFT_59140 predicted protein TREMEDRAFT_70877 similar to hypothetical protein CNBH2840 TREMEDRAFT_42131 similar to hypothetical protein CNBC5720 TREMEDRAFT_59143 predicted protein TREMEDRAFT_18219 similar to hypothetical protein CNBA5000 TREMEDRAFT_59145 predicted protein TREMEDRAFT_24284 similar to predicted protein TREMEDRAFT_59147 predicted protein TREMEDRAFT_59148 similar to hypothetical protein CNBA4890 TREMEDRAFT_59150 predicted protein TREMEDRAFT_59151 predicted protein TREMEDRAFT_67169 similar to conserved hypothetical protein TREMEDRAFT_59153 predicted protein TREMEDRAFT_59155 similar to hypothetical protein CNBA4560 TREMEDRAFT_18336 similar to hypothetical protein CNBA4810 TREMEDRAFT_12690 similar to hypothetical protein CNBA4720 TREMEDRAFT_59159 similar to Myb-like DNA-binding domain containing protein TREMEDRAFT_25547 similar to hypothetical protein CNBA4740 TREMEDRAFT_59161 similar to hypothetical protein MGL_1308 TREMEDRAFT_59162 predicted protein TREMEDRAFT_59163 predicted protein TREMEDRAFT_59164 predicted protein TREMEDRAFT_59166 predicted protein TREMEDRAFT_59167 predicted protein TREMEDRAFT_59168 predicted protein TREMEDRAFT_59170 similar to hypothetical protein CIMG_04839 TREMEDRAFT_59172 predicted protein TREMEDRAFT_59173 predicted protein TREMEDRAFT_59175 predicted protein TREMEDRAFT_26181 similar to pol protein TREMEDRAFT_59179 predicted protein TREMEDRAFT_59181 similar to predicted protein TREMEDRAFT_25011 similar to predicted protein TREMEDRAFT_59183 predicted protein TREMEDRAFT_67175 similar to hypothetical protein CNBA4770 TREMEDRAFT_26438 similar to hypothetical protein CNBA4760 TREMEDRAFT_72961 predicted protein TREMEDRAFT_37115 similar to GTPase regulator Nrf1 (predicted); expressed hypothetical protein TREMEDRAFT_59189 predicted protein TREMEDRAFT_59190 similar to secreted lipase/esterase TREMEDRAFT_59191 similar to hypothetical protein An15g00300 TREMEDRAFT_25510 similar to hypothetical protein CNBE5180 TREMEDRAFT_67181 similar to hypothetical protein CNBA5480 TREMEDRAFT_67182 similar to hypothetical protein CNBA4800 TREMEDRAFT_59195 predicted protein TREMEDRAFT_56108 expressed protein TREMEDRAFT_24992 similar to hypothetical protein CNBL2990 TREMEDRAFT_42150 similar to chitin synthase 6 TREMEDRAFT_59198 similar to hypothetical protein CNBA5100 TREMEDRAFT_42152 similar to hypothetical protein CNBA4910 TREMEDRAFT_67185 similar to hypothetical protein CNBA5010 TREMEDRAFT_22078 similar to hypothetical protein CNBA5590 TREMEDRAFT_72967 similar to hypothetical protein CNA05310 TREMEDRAFT_59204 predicted protein TREMEDRAFT_59205 predicted protein TREMEDRAFT_59206 predicted protein TREMEDRAFT_59208 predicted protein TREMEDRAFT_42161 similar to hypothetical protein CNBA5580 TREMEDRAFT_59210 similar to hypothetical protein CNBA5090 TREMEDRAFT_59211 similar to hypothetical protein CNBE0470 TREMEDRAFT_59212 similar to hypothetical protein CNBE0470 TREMEDRAFT_59213 predicted protein TREMEDRAFT_59214 predicted protein TREMEDRAFT_59215 predicted protein TREMEDRAFT_59216 similar to hypothetical protein CNBA5500 TREMEDRAFT_59217 predicted protein TREMEDRAFT_59218 predicted protein TREMEDRAFT_59220 predicted protein TREMEDRAFT_59221 predicted protein TREMEDRAFT_19299 similar to hypothetical protein CNBL3000 TREMEDRAFT_59223 similar to hypothetical protein, partial TREMEDRAFT_59224 similar to unknown TREMEDRAFT_14396 similar to hypothetical protein CNBL3050 TREMEDRAFT_24338 similar to hypothetical protein CNBL1260 TREMEDRAFT_37133 similar to hypothetical protein CNBA5540 TREMEDRAFT_59227 predicted protein TREMEDRAFT_59228 predicted protein TREMEDRAFT_59229 similar to predicted protein TREMEDRAFT_72972 similar to hypothetical protein CNBA5530 TREMEDRAFT_25562 similar to hypothetical protein CNA05720 TREMEDRAFT_19145 similar to hypothetical protein CNBA5510 TREMEDRAFT_59232 similar to hypothetical protein CNBC7150 TREMEDRAFT_59233 similar to hypothetical protein AN9375.2 TREMEDRAFT_59234 similar to hypothetical protein ELI_09710 TREMEDRAFT_26100 similar to hypothetical protein CNBA5130 TREMEDRAFT_59237 predicted protein TREMEDRAFT_59238 similar to GCN5-related N-acetyltransferase TREMEDRAFT_67197 similar to hypothetical protein CNBL3090 TREMEDRAFT_70892 similar to hypothetical protein CNBL3070 TREMEDRAFT_26799 similar to hypothetical protein CNBL3080 TREMEDRAFT_59243 predicted protein TREMEDRAFT_59244 predicted protein TREMEDRAFT_22893 similar to predicted protein TREMEDRAFT_24355 similar to hypothetical protein CNBE0730 TREMEDRAFT_59247 similar to hypothetical protein CNBC7190 TREMEDRAFT_59248 predicted protein TREMEDRAFT_59249 predicted protein TREMEDRAFT_67203 similar to hypothetical protein CNC00130 TREMEDRAFT_72974 similar to hypothetical protein CNBC7200 TREMEDRAFT_20174 similar to hypothetical protein FG02955.1 TREMEDRAFT_59253 similar to hypothetical protein CNBC7170 TREMEDRAFT_70893 similar to chitin synthase 8; expressed hypothetical protein TREMEDRAFT_22163 similar to hypothetical protein CNBC7100 TREMEDRAFT_59259 similar to hypothetical protein CNBC7080 TREMEDRAFT_59260 predicted protein TREMEDRAFT_24461 similar to predicted protein TREMEDRAFT_56123 expressed protein TREMEDRAFT_59262 predicted protein TREMEDRAFT_59263 predicted protein TREMEDRAFT_42179 similar to hypothetical protein CNBC6750 TREMEDRAFT_26852 similar to hypothetical protein CNBC7030 TREMEDRAFT_59267 predicted protein TREMEDRAFT_59268 predicted protein TREMEDRAFT_25513 similar to hypothetical protein ATEG_08554 TREMEDRAFT_59272 similar to RhoA GTPase effector DIA/Diaphanous TREMEDRAFT_59273 similar to putative thioesterase family protein TREMEDRAFT_59274 predicted protein TREMEDRAFT_59275 similar to beta-lactamase TREMEDRAFT_26353 similar to hypothetical protein CNBA4350 TREMEDRAFT_59278 similar to hypothetical protein CIMG_04839 TREMEDRAFT_59279 predicted protein TREMEDRAFT_26842 similar to hypothetical protein CNBI3380 TREMEDRAFT_59282 similar to hypothetical protein CIMG_04839 TREMEDRAFT_42193 similar to hypothetical protein CNBA4240 TREMEDRAFT_59285 similar to hypothetical protein CNBA4300 TREMEDRAFT_59287 predicted protein TREMEDRAFT_24947 similar to hypothetical protein NEMVEDRAFT_v1g157496 TREMEDRAFT_25355 similar to hypothetical protein CNBA4490 TREMEDRAFT_72986 similar to hypothetical protein CNH03680 TREMEDRAFT_59291 similar to hypothetical protein CNBI2950 TREMEDRAFT_22557 similar to predicted protein TREMEDRAFT_67225 similar to hypothetical protein CNBI2930 TREMEDRAFT_25515 similar to hypothetical protein CNBI2920 TREMEDRAFT_72988 predicted protein TREMEDRAFT_37169 similar to hypothetical protein CNL03880 TREMEDRAFT_25020 similar to hypothetical protein CNBI2960 TREMEDRAFT_59299 predicted protein TREMEDRAFT_26526 similar to hypothetical protein CNBI2860 TREMEDRAFT_59303 predicted protein TREMEDRAFT_59304 predicted protein TREMEDRAFT_59305 predicted protein TREMEDRAFT_59306 predicted protein TREMEDRAFT_72993 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_26586 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_56136 expressed protein TREMEDRAFT_24823 similar to hypothetical protein CNBI2790 TREMEDRAFT_59313 similar to predicted protein TREMEDRAFT_59314 predicted protein TREMEDRAFT_59315 predicted protein TREMEDRAFT_59317 predicted protein TREMEDRAFT_26565 similar to hypothetical protein TREMEDRAFT_59319 similar to hypothetical protein CNBC3430 TREMEDRAFT_42213 similar to hypothetical protein CNBC3440 TREMEDRAFT_70911 similar to GPI anchor biosynthesis-related protein, putative TREMEDRAFT_42219 similar to adenylyl cyclase-associated protein TREMEDRAFT_70913 similar to hypothetical protein CNA03790 TREMEDRAFT_24108 similar to hypothetical protein CNBI2880 TREMEDRAFT_56141 expressed protein TREMEDRAFT_24942 similar to hypothetical protein CNL03940 TREMEDRAFT_59329 similar to protein monoubiquitination-related protein, putative TREMEDRAFT_59330 similar to hypothetical protein CNL04010 TREMEDRAFT_59332 similar to predicted protein TREMEDRAFT_25187 similar to hypothetical protein CNBI2750 TREMEDRAFT_59334 similar to hypothetical protein CNBI2740 TREMEDRAFT_59335 predicted protein TREMEDRAFT_42227 similar to GPI mannosyltransferase 2 (GPI mannosyltransferase II) (GPI-MT-II) (Glycosylphosphatidylinositol-anchor biosynthesis protein 18) TREMEDRAFT_26196 similar to AGR031Wp TREMEDRAFT_42231 similar to hypothetical protein CNBE0090 TREMEDRAFT_25064 similar to hypothetical protein CNBA3820 TREMEDRAFT_67251 similar to predicted protein TREMEDRAFT_37204 similar to hypothetical protein CNBI2640 TREMEDRAFT_59343 similar to hypothetical protein CNBI2630 TREMEDRAFT_59344 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_25370 similar to hypothetical protein CNBK0480 TREMEDRAFT_59346 similar to hypothetical protein CNBA3720 TREMEDRAFT_14351 similar to hypothetical protein CC1G_10722 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59348 similar to hypothetical protein CNBI2600 TREMEDRAFT_25042 similar to thiamine pyrophosphokinase, putative TREMEDRAFT_59351 similar to Balbiani ring protein 1-beta (clone 18-2) - midge (Chironomus pallidivittatus) (fragments) TREMEDRAFT_59352 predicted protein TREMEDRAFT_73008 similar to Potential protein lysine methyltransferase SET5 (SET domain-containing protein 5); expressed hypothetical protein TREMEDRAFT_73009 similar to hypothetical protein CNA04170 TREMEDRAFT_42241 similar to hypothetical protein CNBA3990 TREMEDRAFT_67258 similar to hypothetical protein CNBA3980 TREMEDRAFT_24208 similar to predicted protein TREMEDRAFT_56147 similar to novel protein similar to human and mouse ring finger protein 165 (RNF165); expressed hypothetical protein TREMEDRAFT_37220 similar to hypothetical protein CNBA3610 TREMEDRAFT_56148 expressed protein TREMEDRAFT_59361 predicted protein TREMEDRAFT_59362 similar to serine/threonin kinase, putative TREMEDRAFT_26192 similar to predicted protein TREMEDRAFT_59367 predicted protein TREMEDRAFT_59368 predicted protein TREMEDRAFT_26102 similar to hypothetical protein CNBC2440 TREMEDRAFT_59370 predicted protein TREMEDRAFT_59371 predicted protein TREMEDRAFT_59372 predicted protein TREMEDRAFT_59375 predicted protein TREMEDRAFT_59376 predicted protein TREMEDRAFT_59377 predicted protein TREMEDRAFT_59379 predicted protein TREMEDRAFT_59380 similar to hypothetical protein CNBA4040 TREMEDRAFT_73017 similar to cyclin TREMEDRAFT_42256 similar to hypothetical protein CNBA4070 TREMEDRAFT_24454 similar to hypothetical protein CNBA4050 TREMEDRAFT_24507 similar to hypothetical protein CNBA4060 TREMEDRAFT_59386 similar to hypothetical protein CNBA3740 TREMEDRAFT_13725 similar to hypothetical protein CNBA3960 TREMEDRAFT_25546 similar to hypothetical protein CNBA3950 TREMEDRAFT_24534 similar to hypothetical protein CNBA3940 TREMEDRAFT_12801 similar to hypothetical protein CNBA3930 TREMEDRAFT_59390 predicted protein TREMEDRAFT_59392 predicted protein TREMEDRAFT_25048 similar to hypothetical protein CNBF1830 TREMEDRAFT_59394 predicted protein TREMEDRAFT_59396 similar to hypothetical protein CIMG_04839 TREMEDRAFT_59397 predicted protein TREMEDRAFT_59398 predicted protein TREMEDRAFT_59400 similar to proline-rich family protein TREMEDRAFT_59401 predicted protein TREMEDRAFT_59403 predicted protein TREMEDRAFT_25387 similar to hypothetical protein CNBA3870 TREMEDRAFT_24904 similar to hypothetical protein CNBA3880 TREMEDRAFT_26022 similar to hypothetical protein CNBA3890 TREMEDRAFT_59407 similar to hypothetical protein CNBA3900 TREMEDRAFT_56155 similar to elongation factor 1-gamma (ef-1-gamma), putative; expressed hypothetical protein TREMEDRAFT_59409 predicted protein TREMEDRAFT_59410 similar to hypothetical protein CNBA4230 TREMEDRAFT_59413 predicted protein TREMEDRAFT_22812 similar to conserved hypothetical protein TREMEDRAFT_25795 similar to hypothetical protein CNBA3910 TREMEDRAFT_59416 predicted protein TREMEDRAFT_59417 similar to hypothetical protein TREMEDRAFT_67284 similar to hypothetical protein CNBC1060 TREMEDRAFT_26825 similar to hypothetical protein CNBA4150 TREMEDRAFT_59420 similar to hypothetical protein OG2516_00624 TREMEDRAFT_59421 similar to conserved hypothetical protein TREMEDRAFT_24795 similar to hypothetical protein CNBK1390 TREMEDRAFT_59423 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_22292 similar to predicted protein TREMEDRAFT_59425 predicted protein TREMEDRAFT_22980 similar to hypothetical protein CNBK1570 TREMEDRAFT_26399 similar to endoplasmic reticulum protein, putative; expressed hypothetical protein TREMEDRAFT_59428 predicted protein TREMEDRAFT_42281 similar to hypothetical protein CNBK1640 TREMEDRAFT_59430 predicted protein TREMEDRAFT_59431 similar to hypothetical protein CNK01920 TREMEDRAFT_67295 similar to hypothetical protein CNBK1590 TREMEDRAFT_59434 similar to hCG2042888, isoform CRA_a TREMEDRAFT_24951 similar to hypothetical protein CNBK1510 TREMEDRAFT_59436 predicted protein TREMEDRAFT_24846 similar to hypothetical protein CNBK1490 TREMEDRAFT_59439 predicted protein TREMEDRAFT_59440 predicted protein TREMEDRAFT_73028 similar to hypothetical protein CNK01730 TREMEDRAFT_24439 similar to hypothetical protein CNK02080 TREMEDRAFT_67302 similar to hypothetical protein CNBK1470 TREMEDRAFT_59444 predicted protein TREMEDRAFT_59445 similar to hypothetical protein TREMEDRAFT_73029 similar to GNAT family acetyltransferase, putative TREMEDRAFT_25593 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_25118 similar to hypothetical protein CNK01610 TREMEDRAFT_25385 similar to UDP-glucose 4-epimerase TREMEDRAFT_59450 similar to hypothetical protein CNBF1090 TREMEDRAFT_25086 similar to hypothetical protein CNBK1890 TREMEDRAFT_59452 similar to hypothetical protein CNK01660 TREMEDRAFT_25258 similar to hypothetical protein CNBK1410 TREMEDRAFT_24544 similar to hypothetical protein CNBK1430 TREMEDRAFT_59457 predicted protein TREMEDRAFT_59460 predicted protein TREMEDRAFT_59461 similar to hypothetical protein CNBK1710 TREMEDRAFT_70943 similar to hypothetical protein CNBK1840 TREMEDRAFT_59464 similar to hypothetical protein CNK01770 TREMEDRAFT_73037 similar to hypothetical protein TREMEDRAFT_59466 similar to hypothetical protein CNK01760 TREMEDRAFT_59470 predicted protein TREMEDRAFT_59471 predicted protein TREMEDRAFT_70947 expressed protein TREMEDRAFT_56178 expressed protein TREMEDRAFT_59474 predicted protein TREMEDRAFT_59475 predicted protein TREMEDRAFT_59476 predicted protein TREMEDRAFT_67322 similar to hypothetical protein CNBK3080 TREMEDRAFT_59478 predicted protein TREMEDRAFT_59479 predicted protein TREMEDRAFT_59480 predicted protein TREMEDRAFT_59481 similar to hypothetical protein CHGG_03442 TREMEDRAFT_59483 similar to hypothetical protein CNBK3220 TREMEDRAFT_73044 similar to hypothetical protein CNBK3330 TREMEDRAFT_67326 similar to hypothetical protein CNK00370 TREMEDRAFT_73045 similar to hypothetical protein CNK00250 TREMEDRAFT_73046 expressed protein TREMEDRAFT_59491 predicted protein TREMEDRAFT_59492 predicted protein TREMEDRAFT_59493 predicted protein TREMEDRAFT_26044 similar to hypothetical protein CC1G_10017 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59498 predicted protein TREMEDRAFT_59499 predicted protein TREMEDRAFT_59500 predicted protein TREMEDRAFT_73048 predicted protein TREMEDRAFT_70952 similar to hypothetical protein CNBK2590 TREMEDRAFT_59504 predicted protein TREMEDRAFT_25267 similar to hypothetical protein CC1G_00106 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_73051 similar to hypothetical protein CNBK3040 TREMEDRAFT_59507 predicted protein TREMEDRAFT_26121 similar to hypothetical protein MGG_13314 TREMEDRAFT_59509 predicted protein TREMEDRAFT_59510 predicted protein TREMEDRAFT_59511 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59512 similar to hypothetical protein CNBK3020 TREMEDRAFT_59513 predicted protein TREMEDRAFT_59514 predicted protein TREMEDRAFT_59515 predicted protein TREMEDRAFT_59516 similar to hypothetical protein CaO19.11553 TREMEDRAFT_56186 expressed protein TREMEDRAFT_59518 predicted protein TREMEDRAFT_59519 predicted protein TREMEDRAFT_59520 predicted protein TREMEDRAFT_59521 predicted protein TREMEDRAFT_24529 similar to hypothetical protein CNBK2750 TREMEDRAFT_26174 similar to conserved hypothetical protein TREMEDRAFT_26249 similar to predicted protein TREMEDRAFT_59526 predicted protein TREMEDRAFT_59527 predicted protein TREMEDRAFT_59528 predicted protein TREMEDRAFT_59529 predicted protein TREMEDRAFT_67336 similar to hypothetical protein CNBK2570 TREMEDRAFT_59531 predicted protein TREMEDRAFT_59532 similar to JUN protein TREMEDRAFT_59533 predicted protein TREMEDRAFT_59534 predicted protein TREMEDRAFT_59535 predicted protein TREMEDRAFT_70956 similar to hypothetical protein CNBK3100 TREMEDRAFT_59538 predicted protein TREMEDRAFT_59539 predicted protein TREMEDRAFT_59540 predicted protein TREMEDRAFT_59541 predicted protein TREMEDRAFT_59542 predicted protein TREMEDRAFT_59544 predicted protein TREMEDRAFT_59545 similar to hypothetical protein CNBC1040 TREMEDRAFT_73057 similar to predicted protein TREMEDRAFT_24262 similar to short chain dehydrogenase, putative TREMEDRAFT_70959 similar to NAD(P) transhydrogenase, mitochondrial precursor TREMEDRAFT_24957 similar to oxidoreductase, putative TREMEDRAFT_25331 similar to hypothetical protein CC1G_03943 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59551 predicted protein TREMEDRAFT_70962 similar to hypothetical protein CNBD1770 TREMEDRAFT_56196 expressed protein TREMEDRAFT_67347 similar to hypothetical protein CNBD1760 TREMEDRAFT_26806 similar to hypothetical protein CNBI3610 TREMEDRAFT_24768 similar to hypothetical protein CNH03250 TREMEDRAFT_59556 predicted protein TREMEDRAFT_73061 similar to hypothetical protein CNBI3580 TREMEDRAFT_25378 similar to hypothetical protein CNBI3570 TREMEDRAFT_59559 predicted protein TREMEDRAFT_59560 predicted protein TREMEDRAFT_59561 predicted protein TREMEDRAFT_59562 predicted protein TREMEDRAFT_59563 predicted protein TREMEDRAFT_14364 similar to hypothetical protein CNBI3500 TREMEDRAFT_26315 similar to hypothetical protein CNBD1740 TREMEDRAFT_59567 predicted protein TREMEDRAFT_59568 similar to hCG1793893 TREMEDRAFT_24902 similar to hypothetical protein CNBC5170 TREMEDRAFT_59570 predicted protein TREMEDRAFT_73064 similar to hypothetical protein CNH03270 TREMEDRAFT_73065 predicted protein TREMEDRAFT_59576 predicted protein TREMEDRAFT_26011 similar to hypothetical protein CNBI3310 TREMEDRAFT_26015 similar to predicted protein TREMEDRAFT_25550 similar to hypothetical protein CNBI3360 TREMEDRAFT_24680 similar to hypothetical protein CNBI3350 TREMEDRAFT_25682 similar to hypothetical protein CNH03350 TREMEDRAFT_59583 predicted protein TREMEDRAFT_59584 predicted protein TREMEDRAFT_73067 similar to hypothetical protein CNH03440 TREMEDRAFT_59587 predicted protein TREMEDRAFT_59589 predicted protein TREMEDRAFT_73069 similar to hypothetical protein CNBI3410 TREMEDRAFT_73071 similar to hypothetical protein CNBD1750 TREMEDRAFT_24392 similar to hypothetical protein CNH03570 TREMEDRAFT_59594 similar to hypothetical protein CNBI3440 TREMEDRAFT_59595 predicted protein TREMEDRAFT_59596 similar to hypothetical protein CNBI3230 TREMEDRAFT_25178 similar to hypothetical protein CNBI3540 TREMEDRAFT_59598 similar to hypothetical protein CNBI3390 TREMEDRAFT_59599 similar to hypothetical protein UM00724.1 TREMEDRAFT_67366 similar to Glutamyl-tRNA(Gln) amidotransferase subunit A (amidase) TREMEDRAFT_59602 predicted protein TREMEDRAFT_59603 predicted protein TREMEDRAFT_59605 predicted protein TREMEDRAFT_59607 predicted protein TREMEDRAFT_59608 similar to hypothetical protein DEHA0E25971g TREMEDRAFT_59609 similar to hypothetical protein CC1G_11737 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59612 predicted protein TREMEDRAFT_59613 predicted protein TREMEDRAFT_59614 predicted protein TREMEDRAFT_59615 predicted protein TREMEDRAFT_59616 predicted protein TREMEDRAFT_24841 similar to hypothetical protein CNBD2180 TREMEDRAFT_67370 similar to conserved hypothetical protein TREMEDRAFT_59620 predicted protein TREMEDRAFT_59621 predicted protein TREMEDRAFT_59622 similar to hypothetical protein CNBC2280 TREMEDRAFT_59623 predicted protein TREMEDRAFT_59624 predicted protein TREMEDRAFT_59625 predicted protein TREMEDRAFT_59626 predicted protein TREMEDRAFT_24323 similar to protein-tyrosine-phosphatase, putative TREMEDRAFT_67372 similar to hypothetical protein CNBD2620 TREMEDRAFT_67373 similar to thiosulfate sulfurtransferase, putative; expressed hypothetical protein TREMEDRAFT_14833 similar to hypothetical protein CND03950 TREMEDRAFT_59632 predicted protein TREMEDRAFT_59633 similar to hypothetical protein CNBD2340 TREMEDRAFT_24935 similar to hypothetical protein CNBD2290 TREMEDRAFT_26157 similar to hypothetical protein CNBD2450 TREMEDRAFT_59640 predicted protein TREMEDRAFT_67381 similar to hypothetical protein TREMEDRAFT_59643 predicted protein TREMEDRAFT_59645 similar to hypothetical protein CIMG_04839 TREMEDRAFT_59647 predicted protein TREMEDRAFT_59648 similar to hypothetical protein CC1G_13189 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59650 predicted protein TREMEDRAFT_59651 predicted protein TREMEDRAFT_26177 similar to hypothetical protein CC1G_04444 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59653 similar to gag TREMEDRAFT_59655 predicted protein TREMEDRAFT_20952 similar to hypothetical protein CNBD2650 TREMEDRAFT_73079 predicted protein TREMEDRAFT_25835 similar to conserved hypothetical protein TREMEDRAFT_59660 predicted protein TREMEDRAFT_59662 similar to conserved hypothetical protein TREMEDRAFT_24836 similar to enzyme regulator, putative TREMEDRAFT_16005 similar to hypothetical protein CNBD2980 TREMEDRAFT_59665 similar to hypothetical protein CNBE0850 TREMEDRAFT_73082 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_24766 similar to hypothetical protein CNBD2390 TREMEDRAFT_59670 similar to predicted protein TREMEDRAFT_24670 similar to hypothetical protein CNBD2640 TREMEDRAFT_59673 similar to vacuole fusion, non-autophagic-related protein, putative TREMEDRAFT_37357 similar to isocitrate dehydrogenase, putative; expressed hypothetical protein TREMEDRAFT_26120 similar to hypothetical protein CNBF2980 TREMEDRAFT_26850 similar to phospholipid-translocating ATPase, putative TREMEDRAFT_59677 similar to hypothetical protein CNBD2700 TREMEDRAFT_59678 predicted protein TREMEDRAFT_24920 similar to SET domain containing 1Bb TREMEDRAFT_59680 similar to hypothetical protein CNBN0140 TREMEDRAFT_70983 similar to Chitin deacetylase precursor TREMEDRAFT_24575 similar to hypothetical protein CNBD2410 TREMEDRAFT_59685 similar to transcription factor binding protein, putative TREMEDRAFT_67398 similar to hypothetical protein CNBD2510 TREMEDRAFT_59687 predicted protein TREMEDRAFT_59688 predicted protein TREMEDRAFT_70985 similar to hypothetical protein CNBD2520 TREMEDRAFT_73089 similar to hypothetical protein CNBD2560 TREMEDRAFT_25033 similar to GrfA protein, putative TREMEDRAFT_59694 predicted protein TREMEDRAFT_59695 similar to hypothetical protein UM01614.1 TREMEDRAFT_59697 predicted protein TREMEDRAFT_26049 similar to hypothetical protein CNBD3010 TREMEDRAFT_59699 similar to predicted protein TREMEDRAFT_25253 similar to spore wall assembly -related protein, putative TREMEDRAFT_59701 predicted protein TREMEDRAFT_42399 similar to glycoside hydrolase family 2 protein TREMEDRAFT_56224 expressed protein TREMEDRAFT_42405 similar to hypothetical protein CNBD2900 TREMEDRAFT_24986 similar to prenyltransferase, putative TREMEDRAFT_24730 similar to hypothetical protein CNBD2920 TREMEDRAFT_59711 predicted protein TREMEDRAFT_59712 predicted protein TREMEDRAFT_59713 predicted protein TREMEDRAFT_59714 predicted protein TREMEDRAFT_26053 similar to hypothetical protein CNBE2950 TREMEDRAFT_59717 predicted protein TREMEDRAFT_59718 similar to predicted protein TREMEDRAFT_59719 predicted protein TREMEDRAFT_59720 predicted protein TREMEDRAFT_67411 similar to hypothetical protein CNBD2950 TREMEDRAFT_42406 similar to arginine biosynthesis-related protein, putative TREMEDRAFT_59723 predicted protein TREMEDRAFT_16022 similar to hypothetical protein CNBD2780 TREMEDRAFT_70991 similar to hypothetical protein CNBD2790 TREMEDRAFT_25687 similar to hypothetical protein CNA07170 TREMEDRAFT_59726 predicted protein TREMEDRAFT_59727 predicted protein TREMEDRAFT_59729 predicted protein TREMEDRAFT_59732 predicted protein TREMEDRAFT_42413 similar to hypothetical protein CNBD2810 TREMEDRAFT_59734 similar to hypothetical protein CNBD3220 TREMEDRAFT_26611 similar to hypothetical protein CNBD3210 TREMEDRAFT_67416 similar to hypothetical protein CNBD3270 TREMEDRAFT_11831 similar to hypothetical protein CC1G_09152 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59739 predicted protein TREMEDRAFT_67419 similar to hypothetical protein CNBD3160 TREMEDRAFT_20069 similar to hypothetical protein CNBD3170 TREMEDRAFT_59741 predicted protein TREMEDRAFT_26727 similar to hypothetical protein CNBD3140 TREMEDRAFT_70994 similar to L-glutamine D-fructose 6-phosphate amidotansferase; expressed hypothetical protein TREMEDRAFT_59744 similar to predicted protein TREMEDRAFT_25665 similar to hypothetical protein CNBD3080 TREMEDRAFT_67428 similar to hypothetical protein CNBD4660 TREMEDRAFT_59749 similar to hypothetical protein CND06260 TREMEDRAFT_25709 similar to predicted protein TREMEDRAFT_67430 similar to hypothetical protein CNBD0190 TREMEDRAFT_67431 similar to hypothetical protein CNBD0300 TREMEDRAFT_59752 similar to predicted protein TREMEDRAFT_70997 similar to hypothetical protein CND02400 TREMEDRAFT_67435 similar to hypothetical protein CNBD3950 TREMEDRAFT_37398 similar to phosphatidyl-N-methylethanolamine N-methyltransferase, putative; expressed hypothetical protein TREMEDRAFT_12580 similar to hypothetical protein CNBD0220 TREMEDRAFT_59759 similar to hypothetical protein CNBD0230 TREMEDRAFT_59761 similar to hypothetical protein CND06080 TREMEDRAFT_26284 similar to hypothetical protein CNBD4030 TREMEDRAFT_59764 predicted protein TREMEDRAFT_59765 similar to UGT84B2 (UDP-glucosyl transferase 84B2) TREMEDRAFT_59766 predicted protein TREMEDRAFT_59767 similar to hypothetical protein CNBD4020 TREMEDRAFT_26215 similar to hypothetical protein CNBD3930 TREMEDRAFT_71004 expressed protein TREMEDRAFT_25081 similar to hypothetical protein CNBD3880 TREMEDRAFT_59773 predicted protein TREMEDRAFT_59775 predicted protein TREMEDRAFT_26074 similar to putative reverse transcriptase-RNaseH-integrase TREMEDRAFT_59777 similar to hypothetical protein CIMG_04839 TREMEDRAFT_59779 predicted protein TREMEDRAFT_56248 expressed protein TREMEDRAFT_67449 similar to hypothetical protein CNBD4540 TREMEDRAFT_73111 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_25229 similar to hypothetical protein CNBD3850 TREMEDRAFT_17955 similar to hypothetical protein CND01780 TREMEDRAFT_20321 similar to hypothetical protein Arth_2347 TREMEDRAFT_59788 similar to hypothetical protein CNE00070 TREMEDRAFT_26647 similar to hypothetical protein CNBD0070 TREMEDRAFT_24548 similar to SMC-related protein MSS2 TREMEDRAFT_25842 similar to predicted protein TREMEDRAFT_26270 similar to hypothetical protein CNBD3840 TREMEDRAFT_13940 similar to suppressor of gal11 null TREMEDRAFT_59795 similar to hypothetical protein CNBD4590 TREMEDRAFT_67459 similar to diphosphomevalonate decarboxylase, putative; expressed hypothetical protein TREMEDRAFT_71010 similar to nicotinate phosphoribosyltransferase, putative; expressed hypothetical protein TREMEDRAFT_59797 similar to hypothetical protein CNL04990 TREMEDRAFT_25949 similar to predicted protein TREMEDRAFT_67462 similar to hypothetical protein CNBD4460 TREMEDRAFT_59801 similar to hypothetical protein CNBD4430 TREMEDRAFT_26610 similar to hypothetical protein CNBD4470 TREMEDRAFT_59804 similar to Conidiation-specific protein 6 TREMEDRAFT_71013 similar to hypothetical protein FG05042.1; expressed hypothetical protein TREMEDRAFT_59807 similar to hypothetical protein CND02190 TREMEDRAFT_59808 similar to hypothetical protein TREMEDRAFT_67469 similar to hypothetical protein CNBD4120 TREMEDRAFT_67470 similar to hypothetical protein CNBK0820 TREMEDRAFT_59813 predicted protein TREMEDRAFT_67471 similar to hypothetical protein CNBD4110 TREMEDRAFT_67472 similar to hypothetical protein CND02260 TREMEDRAFT_59817 similar to hypothetical protein CNBD4500 TREMEDRAFT_59818 predicted protein TREMEDRAFT_59820 predicted protein TREMEDRAFT_71017 similar to hypothetical protein CNBD4630 TREMEDRAFT_73125 similar to hypothetical protein CNBD4420 TREMEDRAFT_24381 similar to hypothetical protein CNBD4200 TREMEDRAFT_59824 similar to hypothetical protein CNBD4210 TREMEDRAFT_59825 similar to hypothetical protein CNBD4210 TREMEDRAFT_26306 similar to hypothetical protein CNBD4080 TREMEDRAFT_59827 predicted protein TREMEDRAFT_24542 similar to chitin deacetylase-like mannoprotein MP98 TREMEDRAFT_59829 similar to hypothetical protein CND02700 TREMEDRAFT_67478 70 kDa subunit of RPA TREMEDRAFT_59831 similar to hypothetical protein CND02680 TREMEDRAFT_59832 predicted protein TREMEDRAFT_59833 similar to hypothetical protein CNBD3680 TREMEDRAFT_25263 similar to hypothetical protein CNBD4150 TREMEDRAFT_67481 similar to hypothetical protein CNBD3690 TREMEDRAFT_67482 similar to hypothetical protein CNBD4160 TREMEDRAFT_67483 similar to hypothetical protein CNBF3380 TREMEDRAFT_59839 similar to hypothetical protein CND02220 TREMEDRAFT_26645 similar to hypothetical protein CNBD4090 TREMEDRAFT_67487 similar to hypothetical protein CC1G_01786 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59843 similar to hypothetical protein CNBD3610 TREMEDRAFT_26919 similar to hypothetical protein CNBD3820 TREMEDRAFT_73129 similar to hypothetical protein CND02140 TREMEDRAFT_59846 similar to hypothetical protein CND02130 TREMEDRAFT_25619 similar to hypothetical protein CNBD4060 TREMEDRAFT_25741 similar to hypothetical protein CNBD4530 TREMEDRAFT_59852 predicted protein TREMEDRAFT_67496 similar to hypothetical protein CNBD4520 TREMEDRAFT_73132 similar to hypothetical protein CND02530 TREMEDRAFT_59855 predicted protein TREMEDRAFT_37459 similar to hypothetical protein CNBD4390 TREMEDRAFT_59857 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_37462 similar to Phosphatidylglycerol/phosphatidylinositol transfer protein precursor (PG/PI-TP); expressed hypothetical protein TREMEDRAFT_59859 similar to hypothetical protein CNBD4360 TREMEDRAFT_73137 similar to hypothetical protein CNBD3730 TREMEDRAFT_67501 similar to hypothetical protein UM03164.1 TREMEDRAFT_42491 similar to hypothetical protein CNBD3760 TREMEDRAFT_59866 similar to hypothetical protein CNBC2380 TREMEDRAFT_25585 similar to predicted protein TREMEDRAFT_56277 expressed protein TREMEDRAFT_59869 similar to hypothetical protein CNBD3340 TREMEDRAFT_25485 similar to conjugation with cellular fusion-related protein, putative TREMEDRAFT_73141 similar to hypothetical protein CNBD3370 TREMEDRAFT_24408 similar to hypothetical protein CND02980 TREMEDRAFT_24636 similar to hypothetical protein CND02770 TREMEDRAFT_59874 predicted protein TREMEDRAFT_59875 predicted protein TREMEDRAFT_67508 similar to hypothetical protein CND02920 TREMEDRAFT_67509 similar to hypothetical protein CNBD3450 TREMEDRAFT_67510 similar to conserved hypothetical protein TREMEDRAFT_25139 similar to hypothetical protein CC1G_09006 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_59880 predicted protein TREMEDRAFT_59881 predicted protein TREMEDRAFT_59882 predicted protein TREMEDRAFT_59883 predicted protein TREMEDRAFT_59885 predicted protein TREMEDRAFT_59886 predicted protein TREMEDRAFT_59887 predicted protein TREMEDRAFT_73144 predicted protein TREMEDRAFT_56280 expressed protein TREMEDRAFT_59892 predicted protein TREMEDRAFT_73146 similar to unnamed protein product TREMEDRAFT_59894 similar to hypothetical protein DEHA0E10626g TREMEDRAFT_59895 similar to hypothetical protein UM01476.1 TREMEDRAFT_67516 similar to hypothetical protein CNK02930 TREMEDRAFT_27348 similar to hypothetical protein CNH02610 TREMEDRAFT_42508 similar to hypothetical protein CNBN1530 TREMEDRAFT_59901 similar to predicted protein TREMEDRAFT_13278 similar to cAMP-dependent protein kinase catalytic subunit beta TREMEDRAFT_67519 similar to hypothetical protein MGL_1445 TREMEDRAFT_59906 similar to hypothetical protein CNBK3340 TREMEDRAFT_27331 similar to hypothetical protein CNBJ0100 TREMEDRAFT_59908 predicted protein TREMEDRAFT_59910 similar to hypothetical protein CNL05020 TREMEDRAFT_11630 similar to shuttle craft like transcriptional regulator, putative TREMEDRAFT_59912 predicted protein TREMEDRAFT_59914 similar to hypothetical protein CIMG_04839 TREMEDRAFT_59916 predicted protein TREMEDRAFT_59918 predicted protein TREMEDRAFT_59919 predicted protein TREMEDRAFT_27045 similar to hypothetical protein TREMEDRAFT_59921 predicted protein TREMEDRAFT_67523 similar to hypothetical protein TREMEDRAFT_59923 predicted protein TREMEDRAFT_28125 similar to hypothetical protein CNBN0870 TREMEDRAFT_59925 predicted protein TREMEDRAFT_59926 predicted protein TREMEDRAFT_59928 predicted protein TREMEDRAFT_26974 similar to hypothetical protein CNBF1830 TREMEDRAFT_59930 predicted protein TREMEDRAFT_59932 predicted protein TREMEDRAFT_56288 expressed protein TREMEDRAFT_59937 predicted protein TREMEDRAFT_59938 predicted protein TREMEDRAFT_27959 similar to hypothetical protein CNBJ0200 TREMEDRAFT_73154 predicted protein TREMEDRAFT_59941 predicted protein TREMEDRAFT_59942 predicted protein TREMEDRAFT_59943 predicted protein TREMEDRAFT_59944 similar to hypothetical protein CNJ03210 TREMEDRAFT_59946 predicted protein TREMEDRAFT_59947 predicted protein TREMEDRAFT_59948 predicted protein TREMEDRAFT_59949 predicted protein TREMEDRAFT_59951 predicted protein TREMEDRAFT_59953 predicted protein TREMEDRAFT_26973 similar to conserved hypothetical protein TREMEDRAFT_59955 predicted protein TREMEDRAFT_59957 predicted protein TREMEDRAFT_71037 similar to hypothetical protein CNL05030 TREMEDRAFT_27503 similar to hypothetical protein CNBI3260 TREMEDRAFT_73159 predicted protein TREMEDRAFT_56293 expressed protein TREMEDRAFT_59963 predicted protein TREMEDRAFT_37511 similar to homoserine dehydrogenase Hom6; expressed hypothetical protein TREMEDRAFT_59965 similar to hypothetical protein CNBJ0520 TREMEDRAFT_27701 similar to hypothetical protein CNBJ0530 TREMEDRAFT_28090 similar to hypothetical protein CNBJ1380 TREMEDRAFT_59969 similar to tandem pore domain K+ channel TREMEDRAFT_27313 similar to short-chain dehydrogenase/reductase SDR TREMEDRAFT_27133 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_59972 similar to dentin matrix protein 1 TREMEDRAFT_59973 similar to hypothetical protein CNBJ0800 TREMEDRAFT_59974 predicted protein TREMEDRAFT_27559 similar to hypothetical protein CNBJ1440 TREMEDRAFT_56297 expressed protein TREMEDRAFT_59976 predicted protein TREMEDRAFT_24246 similar to predicted protein TREMEDRAFT_27278 similar to hypothetical protein CNBJ0890 TREMEDRAFT_27931 similar to tetraspanin Pls1 family TREMEDRAFT_73164 predicted protein TREMEDRAFT_73166 similar to hypothetical protein CNJ02130 TREMEDRAFT_59985 similar to hypothetical protein TREMEDRAFT_73167 similar to hypothetical protein CNJ02180 TREMEDRAFT_59988 similar to hypothetical protein CNBJ0680 TREMEDRAFT_59989 similar to nucleoside triphosphate pyrophosphohydrolase, marked preference for dGTP TREMEDRAFT_27547 similar to hypothetical protein CC1G_12024 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_27507 similar to hypothetical protein CNBJ0820 TREMEDRAFT_19329 similar to hypothetical protein CNBJ0770 TREMEDRAFT_59997 similar to potential nuclear localization sequence binding protein Nsr1p TREMEDRAFT_73174 predicted protein TREMEDRAFT_60001 similar to hypothetical protein CNBJ0740 TREMEDRAFT_60002 predicted protein TREMEDRAFT_60003 similar to predicted protein TREMEDRAFT_42550 similar to hypothetical protein CNBJ0570 TREMEDRAFT_56309 expressed protein TREMEDRAFT_60005 similar to hypothetical protein CNBJ1200 TREMEDRAFT_71050 similar to hypothetical protein CNBJ1070 TREMEDRAFT_28108 similar to hypothetical protein CNBJ1180 TREMEDRAFT_60009 predicted protein TREMEDRAFT_67548 similar to hypothetical protein CNBJ1160 TREMEDRAFT_16901 similar to hypothetical protein CNBJ1150 TREMEDRAFT_60012 similar to Hypothetical nuclear protein TREMEDRAFT_60014 similar to hypothetical protein CNBJ1120 TREMEDRAFT_73179 similar to hypothetical protein CNJ02310 TREMEDRAFT_67553 similar to hypothetical protein CNJ02890 TREMEDRAFT_27734 similar to hypothetical protein CNBJ0480 TREMEDRAFT_60020 similar to hypothetical protein FG06058.1 TREMEDRAFT_60022 similar to hypothetical protein CNBJ0360 TREMEDRAFT_27206 similar to hypothetical protein CNBJ0260 TREMEDRAFT_27244 similar to hypothetical protein CNBJ1080 TREMEDRAFT_60026 similar to hypothetical protein CNBJ1100 TREMEDRAFT_60027 similar to rCG55116 TREMEDRAFT_56319 predicted protein TREMEDRAFT_67560 expressed protein TREMEDRAFT_11544 similar to hypothetical protein CNBJ0270 TREMEDRAFT_42570 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_60031 similar to hypothetical protein CNBJ1430 TREMEDRAFT_28205 similar to hypothetical protein CNBJ0580 TREMEDRAFT_60034 predicted protein TREMEDRAFT_26996 similar to hypothetical protein CNBJ1390 TREMEDRAFT_42575 similar to hypothetical protein CNBJ1410 TREMEDRAFT_19532 similar to hypothetical protein CNBJ1050 TREMEDRAFT_28352 similar to hypothetical protein CNBB3890 TREMEDRAFT_60039 similar to hypothetical protein FG03938.1 TREMEDRAFT_60040 similar to hypothetical protein CC1G_03614 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_28240 similar to hypothetical protein CNBJ0550 TREMEDRAFT_60042 similar to DnaJ (Hsp40) homolog, subfamily B, member 4 TREMEDRAFT_27125 similar to hypothetical protein CNBJ0550 TREMEDRAFT_60044 similar to hypothetical protein CNBJ1000 TREMEDRAFT_67570 similar to hypothetical protein CNBJ0960 TREMEDRAFT_28345 similar to hypothetical protein CNJ02550 TREMEDRAFT_27039 similar to hypothetical protein CNBJ0910 TREMEDRAFT_67574 similar to Dihydrofolate reductase TREMEDRAFT_37568 similar to hypothetical protein CNBJ1540 TREMEDRAFT_60053 similar to hypothetical protein CNBJ0930 TREMEDRAFT_60054 predicted protein TREMEDRAFT_67577 similar to hypothetical protein CNBJ1280 TREMEDRAFT_67578 similar to predicted protein TREMEDRAFT_67581 similar to hypothetical protein CNBJ1240 TREMEDRAFT_27534 similar to hypothetical protein CNBJ1510 TREMEDRAFT_27564 similar to hypothetical protein CNBJ1500 TREMEDRAFT_27432 similar to hypothetical protein CNBJ1490 TREMEDRAFT_60065 similar to hypothetical protein CNBJ1460 TREMEDRAFT_60066 predicted protein TREMEDRAFT_71069 similar to hypothetical protein CNBJ1810 TREMEDRAFT_60068 predicted protein TREMEDRAFT_67590 similar to hypothetical protein CNBJ1620 TREMEDRAFT_60072 similar to hypothetical protein CNBJ1680 TREMEDRAFT_60073 similar to hypothetical protein CNBJ1710 TREMEDRAFT_60074 similar to hypothetical protein CNJ03000 TREMEDRAFT_28265 similar to hypothetical protein CNBJ1600 TREMEDRAFT_27360 similar to hypothetical protein CNBJ1580 TREMEDRAFT_73199 similar to evolved D-pantonohydrolase; expressed hypothetical protein TREMEDRAFT_60078 similar to predicted protein TREMEDRAFT_18983 similar to hypothetical protein CNBJ1560 TREMEDRAFT_67592 similar to hypothetical protein CNBJ1570 TREMEDRAFT_28071 similar to hypothetical protein CNBJ1650 TREMEDRAFT_60085 similar to hypothetical protein CNBJ1910 TREMEDRAFT_73203 similar to hypothetical protein CNBJ1860 TREMEDRAFT_60087 predicted protein TREMEDRAFT_27733 similar to hypothetical protein CNBJ1830 TREMEDRAFT_67599 similar to hypothetical protein CNBJ1690 TREMEDRAFT_27724 similar to hypothetical protein CNJ01800 TREMEDRAFT_67600 similar to hypothetical protein CNBJ1800 TREMEDRAFT_67601 similar to hypothetical protein CNBJ2230 TREMEDRAFT_27794 similar to hypothetical protein CNBJ2220 TREMEDRAFT_27182 similar to hypothetical protein CNBJ2210 TREMEDRAFT_27063 similar to hypothetical protein CNBJ2180 TREMEDRAFT_60098 similar to hypothetical protein CNJ01290 TREMEDRAFT_28279 similar to hypothetical protein CNBJ2160 TREMEDRAFT_27383 similar to hypothetical protein NCU03929 TREMEDRAFT_67606 similar to hypothetical protein CNBJ2100 TREMEDRAFT_67607 expressed protein TREMEDRAFT_56342 expressed protein TREMEDRAFT_71079 similar to hypothetical protein CNBJ1750 TREMEDRAFT_27296 similar to hypothetical protein CNBJ1700 TREMEDRAFT_60105 similar to hypothetical protein CNJ01730 TREMEDRAFT_60107 similar to hypothetical protein CNJ01860 TREMEDRAFT_60108 similar to predicted protein TREMEDRAFT_60109 similar to hypothetical protein CNBJ2200 TREMEDRAFT_73211 similar to hypothetical protein CNJ01590 TREMEDRAFT_15966 similar to mitochondrial carrier protein rim2, putative TREMEDRAFT_60112 similar to predicted protein TREMEDRAFT_60113 predicted protein TREMEDRAFT_27057 similar to predicted protein TREMEDRAFT_60117 similar to hypothetical protein CNBJ1850 TREMEDRAFT_60118 predicted protein TREMEDRAFT_37624 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_60120 similar to hypothetical protein CNBJ2080 TREMEDRAFT_24146 similar to predicted protein TREMEDRAFT_73216 similar to conserved hypothetical protein TREMEDRAFT_60124 predicted protein TREMEDRAFT_60125 predicted protein TREMEDRAFT_60127 similar to gag TREMEDRAFT_60128 similar to hypothetical protein CIMG_04839 TREMEDRAFT_60130 predicted protein TREMEDRAFT_26998 similar to hypothetical protein CC1G_04444 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60132 predicted protein TREMEDRAFT_28055 similar to hypothetical protein CNBJ2150 TREMEDRAFT_56350 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_37629 similar to hypothetical protein CNBJ2090 TREMEDRAFT_60135 predicted protein TREMEDRAFT_26990 similar to hypothetical protein MGG_13587 TREMEDRAFT_60137 predicted protein TREMEDRAFT_60138 predicted protein TREMEDRAFT_60140 similar to hypothetical protein CNBJ2330 TREMEDRAFT_26995 similar to hypothetical protein CNBJ2110 TREMEDRAFT_60142 similar to hypothetical protein CNBD4270 TREMEDRAFT_28230 similar to hypothetical protein CNBJ2000 TREMEDRAFT_60144 similar to ENSANGP00000015605 TREMEDRAFT_60145 predicted protein TREMEDRAFT_60146 predicted protein TREMEDRAFT_60147 similar to Putative protein TPRXL TREMEDRAFT_60148 predicted protein TREMEDRAFT_60149 predicted protein TREMEDRAFT_27051 similar to hypothetical protein CC1G_13042 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60152 predicted protein TREMEDRAFT_27108 similar to hypothetical protein CNBJ2040 TREMEDRAFT_60155 similar to hypothetical protein CNJ01200 TREMEDRAFT_67629 similar to hypothetical protein CNBJ2470 TREMEDRAFT_60161 similar to Pros45 CG1489-PA TREMEDRAFT_27464 similar to hypothetical protein CNBJ2490 TREMEDRAFT_28047 similar to hypothetical protein CNJ00970 TREMEDRAFT_60165 predicted protein TREMEDRAFT_60166 predicted protein TREMEDRAFT_37646 similar to hypothetical protein CNBJ1930 TREMEDRAFT_60170 predicted protein TREMEDRAFT_60171 predicted protein TREMEDRAFT_73227 predicted protein TREMEDRAFT_18910 similar to hypothetical protein CNJ01120 TREMEDRAFT_67635 similar to hypothetical protein CNBJ2360 TREMEDRAFT_16117 similar to hypothetical protein CNBJ2450 TREMEDRAFT_42665 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_60177 similar to hypothetical protein CNBJ2730 TREMEDRAFT_19015 similar to Ras-related protein Rab-21 TREMEDRAFT_13632 similar to hypothetical protein CNBJ2410 TREMEDRAFT_60183 similar to hypothetical protein CNJ01040 TREMEDRAFT_27538 similar to hypothetical protein CNJ01530 TREMEDRAFT_27203 similar to RNA polymerase III transcription factor, putative TREMEDRAFT_67646 similar to hypothetical protein CNBJ2570 TREMEDRAFT_71103 expressed protein TREMEDRAFT_67650 similar to hypothetical protein CNJ00770 TREMEDRAFT_60193 similar to hypothetical protein CNBJ2600 TREMEDRAFT_67653 similar to hypothetical protein CNBJ2650 TREMEDRAFT_60195 predicted protein TREMEDRAFT_60198 similar to proteophosphoglycan ppg4 [Leishmania braziliensis MHOM/BR/75/M2904] TREMEDRAFT_28283 similar to hypothetical protein CNBJ2850 TREMEDRAFT_42706 similar to aspartyl protease; expressed hypothetical protein TREMEDRAFT_73246 predicted protein TREMEDRAFT_60205 predicted protein TREMEDRAFT_73248 similar to hypothetical protein CNBJ3110 TREMEDRAFT_27690 similar to hypothetical protein CNBJ3040 TREMEDRAFT_60212 similar to hypothetical protein CNBJ2920 TREMEDRAFT_73252 similar to hypothetical protein CNJ00100 TREMEDRAFT_67671 similar to hypothetical protein CNBN1690 TREMEDRAFT_27607 similar to hypothetical protein CNBJ2900 TREMEDRAFT_73255 similar to hypothetical protein CNBJ3290 TREMEDRAFT_56387 expressed protein TREMEDRAFT_60221 similar to hypothetical protein CNJ00230 TREMEDRAFT_23443 similar to Mps One Binder kinase activator-like 3 TREMEDRAFT_28361 similar to hypothetical protein CNBG4330 TREMEDRAFT_95280 multi-copper oxidase; putative Fet3 ferroxidase; multiple EST sequences suggest that genomic DNA sequence misses one base (1164372 to 1164378 should read: TACTTTG); the correct protein sequence from the first exon should read: MRSLLCAGLLAATVAKAATLEQWWNITWTTANPDG TREMEDRAFT_60226 similar to hypothetical protein CNBJ3430 TREMEDRAFT_60228 similar to hypothetical protein CNBJ3350 TREMEDRAFT_60230 predicted protein TREMEDRAFT_27395 similar to RNA helicase, putative; expressed hypothetical protein TREMEDRAFT_60234 predicted protein TREMEDRAFT_67686 similar to hypothetical protein CNBA0110 TREMEDRAFT_56395 Potential DyP-like peroxidase, partial transalation, both 5' and 3 ' exons are missing; DyP-type heme-containing peroxidase superfamily TREMEDRAFT_56396 expressed protein TREMEDRAFT_27990 similar to hypothetical protein CNJ00360 TREMEDRAFT_27184 similar to hypothetical protein CC1G_03672 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60241 similar to hypothetical protein CC1G_10657 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60242 predicted protein TREMEDRAFT_27016 similar to putative reverse transcriptase-RNaseH-integrase TREMEDRAFT_60244 similar to zinc finger/thioredoxin putative TREMEDRAFT_56400 expressed protein TREMEDRAFT_67694 similar to hypothetical protein CNBJ3060 TREMEDRAFT_67695 similar to hypothetical protein CNL06580 TREMEDRAFT_60248 similar to hypothetical protein CNBI0300 TREMEDRAFT_67696 similar to hypothetical protein CNBJ2980 TREMEDRAFT_60250 similar to hypothetical protein CNBI0290 TREMEDRAFT_67697 similar to hypothetical protein CNBI0280 TREMEDRAFT_60252 similar to orotidine-5'-phosphate decarboxylase TREMEDRAFT_67699 similar to unnamed protein product TREMEDRAFT_67700 similar to hypothetical protein CNBI3470 TREMEDRAFT_60254 similar to hypothetical protein CNBI3480 TREMEDRAFT_28128 similar to hypothetical protein CNBC7180 TREMEDRAFT_27240 similar to hypothetical protein CNBC4470 TREMEDRAFT_60260 similar to hypothetical protein CNBC7180 TREMEDRAFT_56402 expressed protein TREMEDRAFT_60262 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_37747 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_60266 similar to conserved hypothetical protein TREMEDRAFT_60267 predicted protein TREMEDRAFT_60268 similar to hypothetical protein CNBI0450 TREMEDRAFT_60269 similar to hypothetical protein CNBI0460 TREMEDRAFT_23678 similar to predicted protein TREMEDRAFT_42765 similar to hypothetical protein CNL06660 TREMEDRAFT_27514 similar to hypothetical protein CC1G_10103 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60273 similar to hypothetical protein CNBI0490 TREMEDRAFT_42766 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_28097 similar to hypothetical protein CNBC5980 TREMEDRAFT_27528 similar to conserved hypothetical protein TREMEDRAFT_28397 similar to Nascent polypeptide-associated complex subunit alpha (NAC-alpha) (Alpha-NAC) TREMEDRAFT_37759 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_67719 similar to conserved hypothetical protein TREMEDRAFT_60281 predicted protein TREMEDRAFT_60282 similar to conserved hypothetical protein TREMEDRAFT_67721 similar to hypothetical protein CNL05590 TREMEDRAFT_60285 similar to conserved hypothetical protein TREMEDRAFT_27148 similar to Hypothetical protein CBG12507 TREMEDRAFT_20778 similar to hypothetical protein CNBG0890 TREMEDRAFT_60288 similar to hypothetical protein TREMEDRAFT_60289 predicted protein TREMEDRAFT_71141 similar to hypothetical protein CNBG0790 TREMEDRAFT_60292 predicted protein TREMEDRAFT_60293 similar to hypothetical protein TREMEDRAFT_28036 similar to hypothetical protein CNBG0840 TREMEDRAFT_27877 similar to hypothetical protein CNBG0630 TREMEDRAFT_71142 similar to sulfite reductase (NADPH), putative TREMEDRAFT_14015 similar to hypothetical protein CHGG_10326 TREMEDRAFT_27933 similar to hypothetical protein CNBG0620 TREMEDRAFT_27276 similar to hypothetical protein CNBG0730 TREMEDRAFT_60300 predicted protein TREMEDRAFT_67728 similar to hypothetical protein CNBG1300 TREMEDRAFT_60302 similar to hypothetical protein CIMG_04839 TREMEDRAFT_60304 predicted protein TREMEDRAFT_60306 similar to hypothetical protein TREMEDRAFT_73283 similar to yippee-like, putative; expressed hypothetical protein TREMEDRAFT_60308 predicted protein TREMEDRAFT_60309 predicted protein TREMEDRAFT_27804 similar to exopolyphosphatase, putative TREMEDRAFT_60312 predicted protein TREMEDRAFT_60313 predicted protein TREMEDRAFT_60314 predicted protein TREMEDRAFT_42787 similar to hypothetical protein CNBH1630 TREMEDRAFT_37782 similar to hypothetical protein CNI01700 TREMEDRAFT_67737 similar to hypothetical protein CNBH1640 TREMEDRAFT_15595 similar to hypothetical protein CNBH1650 TREMEDRAFT_73292 similar to insulin degrading enzyme, putative; expressed hypothetical protein TREMEDRAFT_67745 similar to ribosome biogenesis protein, putative TREMEDRAFT_27042 similar to hypothetical protein CNBH1610 TREMEDRAFT_42806 similar to Structure Of The H3-H4 Chaperone Asf1 Bound To Histones H3 And H4; expressed hypothetical protein TREMEDRAFT_60332 predicted protein TREMEDRAFT_73296 similar to hypothetical protein TREMEDRAFT_67748 similar to ARF GTPase activator, putative TREMEDRAFT_60335 similar to hypothetical protein CNL05700 TREMEDRAFT_42810 similar to hypothetical protein CNBH1700 TREMEDRAFT_27200 similar to hypothetical protein CNI01800 TREMEDRAFT_67751 similar to SMC2orf, putative TREMEDRAFT_60340 predicted protein TREMEDRAFT_60341 similar to hypothetical protein TREMEDRAFT_27173 similar to hypothetical protein CNL05720 TREMEDRAFT_60343 similar to hypothetical protein CNBI1080 TREMEDRAFT_27793 similar to hypothetical protein CNBI1020 TREMEDRAFT_27417 similar to hypothetical protein CNBI1010 TREMEDRAFT_67753 similar to hypothetical protein CNI01970 TREMEDRAFT_27247 similar to conserved hypothetical protein TREMEDRAFT_67755 similar to hypothetical protein CNBI1070 TREMEDRAFT_60349 predicted protein TREMEDRAFT_28197 similar to predicted protein TREMEDRAFT_67756 similar to hypothetical protein CNBI1090 TREMEDRAFT_22984 similar to hypothetical protein CNBI0960 TREMEDRAFT_60352 predicted protein TREMEDRAFT_28131 similar to hypothetical protein CNBI0680 TREMEDRAFT_60355 predicted protein TREMEDRAFT_71158 expressed protein TREMEDRAFT_60358 similar to AGAP004994-PA TREMEDRAFT_28077 similar to hypothetical protein CNL06050 TREMEDRAFT_28160 similar to meiotic recombination-related protein, putative TREMEDRAFT_73303 similar to hypothetical protein CNBI0090 TREMEDRAFT_60363 predicted protein TREMEDRAFT_60365 predicted protein TREMEDRAFT_60366 similar to hypothetical protein CNBI0110 TREMEDRAFT_67766 similar to predicted protein TREMEDRAFT_60368 similar to hypothetical protein CNBI0620 TREMEDRAFT_67767 similar to Serine/threonine-protein kinase ATG1 (Autophagy-related protein 1) TREMEDRAFT_73304 similar to riken protein, putative TREMEDRAFT_42828 similar to glutamate-5-semialdehyde dehydrogenase, putative; expressed hypothetical protein TREMEDRAFT_28285 similar to hypothetical protein CNBI1180 TREMEDRAFT_23799 similar to hypothetical protein CNBA4360 TREMEDRAFT_60376 similar to predicted protein TREMEDRAFT_42834 similar to hypothetical protein CNBI0420 TREMEDRAFT_60381 predicted protein TREMEDRAFT_73312 similar to hypothetical protein CNL06430 TREMEDRAFT_73314 similar to GTP-Binding protein lepA, putative TREMEDRAFT_71172 similar to eukaryotic translation initiation factor 2B subunit 2; expressed hypothetical protein TREMEDRAFT_23877 similar to predicted protein TREMEDRAFT_67782 similar to hypothetical protein CNBH1790 TREMEDRAFT_27096 similar to hypothetical protein CNBH1780 TREMEDRAFT_56449 expressed protein TREMEDRAFT_23547 similar to cytoplasm protein, putative TREMEDRAFT_28150 similar to conserved hypothetical protein TREMEDRAFT_60392 similar to hypothetical protein CNC03620 TREMEDRAFT_27400 similar to hypothetical protein CNBG0820 TREMEDRAFT_60394 similar to hypothetical protein CNBF3280 TREMEDRAFT_60395 similar to hypothetical protein TREMEDRAFT_60396 predicted protein TREMEDRAFT_60397 predicted protein TREMEDRAFT_27325 similar to integral to membrane protein, putative; expressed hypothetical protein TREMEDRAFT_73318 predicted protein TREMEDRAFT_60400 predicted protein TREMEDRAFT_60401 predicted protein TREMEDRAFT_60402 predicted protein TREMEDRAFT_27099 similar to hypothetical protein CNBG1170 TREMEDRAFT_42855 similar to prolidase, putative TREMEDRAFT_60405 predicted protein TREMEDRAFT_27317 similar to hypothetical protein CHGG_00128 TREMEDRAFT_60407 similar to unnamed protein product TREMEDRAFT_60408 predicted protein TREMEDRAFT_60409 similar to hypothetical protein AN8241.2 TREMEDRAFT_60410 predicted protein TREMEDRAFT_60411 predicted protein TREMEDRAFT_60413 predicted protein TREMEDRAFT_60414 predicted protein TREMEDRAFT_18036 similar to hypothetical protein CC1G_10917 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60418 predicted protein TREMEDRAFT_60420 predicted protein TREMEDRAFT_60422 predicted protein TREMEDRAFT_67793 similar to hypothetical protein CNBE2800 TREMEDRAFT_22615 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_17849 similar to hypothetical protein CNG03570 TREMEDRAFT_73324 predicted protein TREMEDRAFT_28117 similar to rRNA processing-related protein, putative TREMEDRAFT_28162 similar to hypothetical protein CNBE2880 TREMEDRAFT_60431 similar to hypothetical protein FG08183.1 TREMEDRAFT_60432 similar to hypothetical protein FG08183.1 TREMEDRAFT_27740 similar to hypothetical protein CNBG2020 TREMEDRAFT_60436 similar to cAMP-dependent protein kinase, putative TREMEDRAFT_60437 similar to hypothetical protein TREMEDRAFT_73329 similar to hypothetical protein CNBG1720 TREMEDRAFT_28121 similar to hypothetical protein CNBG1710 TREMEDRAFT_67811 similar to hypothetical protein An01g02500 TREMEDRAFT_27944 similar to hypothetical protein CNA05720 TREMEDRAFT_60446 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60448 predicted protein TREMEDRAFT_60450 predicted protein TREMEDRAFT_60451 predicted protein TREMEDRAFT_60453 predicted protein TREMEDRAFT_60454 similar to hypothetical protein TREMEDRAFT_56473 predicted protein TREMEDRAFT_42900 similar to hypothetical protein CNBE2830 TREMEDRAFT_67817 similar to hypothetical protein CNBE2840 TREMEDRAFT_60459 similar to hypothetical protein CNBE2850 TREMEDRAFT_42903 similar to hypothetical protein CNBE2860 TREMEDRAFT_60461 similar to transcriptional repressor, putative TREMEDRAFT_67822 similar to hypothetical protein CNBG2060 TREMEDRAFT_67823 similar to hypothetical protein SS1G_10940 TREMEDRAFT_60464 predicted protein TREMEDRAFT_60465 predicted protein TREMEDRAFT_60466 predicted protein TREMEDRAFT_60467 predicted protein TREMEDRAFT_42909 similar to conserved hypothetical protein TREMEDRAFT_73336 similar to hypothetical protein TREMEDRAFT_60470 similar to hypothetical protein TREMEDRAFT_56482 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_73338 similar to hypothetical protein CNBG1830 TREMEDRAFT_27647 similar to hypothetical protein CNG02910 TREMEDRAFT_27105 similar to hypothetical protein CNBG1870 TREMEDRAFT_42920 similar to hypothetical protein CNG02860 TREMEDRAFT_27243 similar to hypothetical protein CC1G_12357 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_37929 similar to membrane protein, putative; expressed hypothetical protein TREMEDRAFT_60481 predicted protein TREMEDRAFT_27480 similar to hypothetical protein CNBD3700 TREMEDRAFT_27843 similar to hypothetical protein TREMEDRAFT_22545 similar to predicted protein TREMEDRAFT_60485 predicted protein TREMEDRAFT_60486 similar to hypothetical protein CNBH4070 TREMEDRAFT_60487 similar to hypothetical protein CNBG1970 TREMEDRAFT_26965 similar to Ensemble Refinement Of The Protein Crystal Structure Of A Putative Phosphoprotein Phosphatase From Arabidopsis Thaliana Gene At1g05000 TREMEDRAFT_27266 similar to conserved hypothetical protein TREMEDRAFT_42931 similar to arginine N-methyltransferase 3, putative; expressed hypothetical protein TREMEDRAFT_27301 similar to hypothetical protein CNBE1620 TREMEDRAFT_67844 similar to hypothetical protein TREMEDRAFT_28201 similar to conserved hypothetical protein TREMEDRAFT_27459 similar to hypothetical protein CNBG1980 TREMEDRAFT_27280 similar to predicted protein TREMEDRAFT_27838 similar to hypothetical protein TREMEDRAFT_60500 similar to tropomyosin invertebrate TREMEDRAFT_73350 similar to hypothetical protein CNBE2420 TREMEDRAFT_27844 similar to hypothetical protein CNBG1920 TREMEDRAFT_67852 similar to hypothetical protein CNBE1930 TREMEDRAFT_28204 similar to nuclear mRNA splicing protein TREMEDRAFT_27405 similar to predicted protein TREMEDRAFT_27309 similar to UDP-N-acetylglucosamine transporter, putative; expressed hypothetical protein TREMEDRAFT_60511 similar to hypothetical protein TREMEDRAFT_60512 predicted protein TREMEDRAFT_60513 predicted protein TREMEDRAFT_42952 similar to Phosphoribosylaminoimidazole carboxylase (AIR carboxylase) (AIRC); expressed hypothetical protein TREMEDRAFT_27310 similar to protoplast regeneration and killer toxin resistance gene TREMEDRAFT_28299 similar to cadmium ion transporter, putative TREMEDRAFT_37957 similar to la ribonucleoprotein, putative; expressed hypothetical protein TREMEDRAFT_67860 similar to hypothetical protein CNBK0570 TREMEDRAFT_28172 similar to hypothetical protein CNBE2510 TREMEDRAFT_60521 similar to Os08g0300100 TREMEDRAFT_60523 similar to flagellar biosynthesis regulator FlhF TREMEDRAFT_60524 predicted protein TREMEDRAFT_20294 similar to hypothetical protein MGL_0918 TREMEDRAFT_27765 similar to cadmium ion transporter, putative TREMEDRAFT_60530 predicted protein TREMEDRAFT_60531 similar to hypothetical protein CHGG_04044 TREMEDRAFT_60532 predicted protein TREMEDRAFT_71211 similar to hypothetical protein CNBE2500 TREMEDRAFT_16423 similar to conserved hypothetical protein TREMEDRAFT_27711 similar to hypothetical protein CNBE2730 TREMEDRAFT_60536 predicted protein TREMEDRAFT_27287 similar to cytoplasm protein, putative TREMEDRAFT_14387 similar to hypothetical protein CNBK0570 TREMEDRAFT_60540 similar to hypothetical protein CNBE2480 TREMEDRAFT_60541 similar to hypothetical protein CNG02060 TREMEDRAFT_60542 predicted protein TREMEDRAFT_27013 similar to hypothetical protein CC1G_04444 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60544 predicted protein TREMEDRAFT_60545 predicted protein TREMEDRAFT_60546 predicted protein TREMEDRAFT_60548 predicted protein TREMEDRAFT_37964 similar to glucan 1,4-alpha-glucosidase, putative TREMEDRAFT_27190 similar to cell wall organization and biogenesis-related protein, putative TREMEDRAFT_60552 predicted protein TREMEDRAFT_60553 similar to OSJNBb0108J11.9, partial TREMEDRAFT_28045 similar to hypothetical protein CHLREDRAFT_120954 TREMEDRAFT_22249 similar to hypothetical protein CNBE1580 TREMEDRAFT_28109 similar to hypothetical protein CNBE1570 TREMEDRAFT_27600 similar to predicted protein TREMEDRAFT_71213 similar to hypothetical protein CNE02650 TREMEDRAFT_60558 similar to predicted protein TREMEDRAFT_73361 similar to hypothetical protein TREMEDRAFT_71215 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_60561 similar to dienelactone hydrolase family protein TREMEDRAFT_67874 similar to hypothetical protein CNE01550 TREMEDRAFT_67877 similar to hypothetical protein CNBE2100 TREMEDRAFT_60566 similar to extracellular matrix protein TREMEDRAFT_67879 similar to hypothetical protein CNE02150 TREMEDRAFT_37980 similar to glutathione-disulfide reductase, putative TREMEDRAFT_60571 predicted protein TREMEDRAFT_24092 similar to hypothetical protein CNBE2550 TREMEDRAFT_27975 similar to conserved hypothetical protein TREMEDRAFT_73368 similar to hypothetical protein TREMEDRAFT_60575 predicted protein TREMEDRAFT_60576 predicted protein TREMEDRAFT_60577 predicted protein TREMEDRAFT_27964 similar to Os06g0274200 TREMEDRAFT_27179 similar to hypothetical protein CNBE1710 TREMEDRAFT_27142 similar to hypothetical protein CNBE1730 TREMEDRAFT_42980 similar to cyclin binding protein, putative TREMEDRAFT_28127 similar to hypothetical protein CNE02080 TREMEDRAFT_73370 predicted protein TREMEDRAFT_71222 expressed protein TREMEDRAFT_56503 expressed protein TREMEDRAFT_42981 similar to hypothetical protein TREMEDRAFT_37987 similar to uracil phosphoribosyltransferase, putative; expressed hypothetical protein TREMEDRAFT_27752 similar to hypothetical protein CNBE2360 TREMEDRAFT_27638 similar to ATP binding protein, putative TREMEDRAFT_37989 similar to hypothetical protein TREMEDRAFT_71225 similar to hypothetical protein CNBD1860 TREMEDRAFT_42991 similar to hypothetical protein CNBE2400 TREMEDRAFT_15869 similar to hypothetical protein CNBE1690 TREMEDRAFT_60595 predicted protein TREMEDRAFT_60596 predicted protein TREMEDRAFT_27000 similar to hypothetical protein CNE02010 TREMEDRAFT_73380 similar to hypothetical protein CNBE1890 TREMEDRAFT_60601 similar to hypothetical protein CNE02300 TREMEDRAFT_43009 similar to hypothetical protein CNBE2340 TREMEDRAFT_71235 similar to asparagine-tRNA ligase, putative TREMEDRAFT_73384 expressed protein TREMEDRAFT_15649 similar to conserved hypothetical protein TREMEDRAFT_60607 predicted protein TREMEDRAFT_28248 similar to hypothetical protein CNE01440 TREMEDRAFT_71238 similar to hypothetical protein CNBE1430 TREMEDRAFT_28260 similar to hypothetical protein CC1G_05095 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60613 similar to predicted protein TREMEDRAFT_60614 similar to hypothetical protein CNE01470 TREMEDRAFT_27162 similar to hypothetical protein CNBE1150 TREMEDRAFT_28085 similar to hypothetical protein CNE01210 TREMEDRAFT_60618 similar to hypothetical protein CNBE1410 TREMEDRAFT_20118 similar to hypothetical protein CNBE1180 TREMEDRAFT_23431 similar to Erv2p TREMEDRAFT_28153 similar to hypothetical protein CNBF1830 TREMEDRAFT_60620 predicted protein TREMEDRAFT_60621 predicted protein TREMEDRAFT_60622 predicted protein TREMEDRAFT_28290 similar to hypothetical protein BMA10247_A2353 TREMEDRAFT_26982 similar to retrotransposon nucleocapsid protein, putative TREMEDRAFT_60624 predicted protein TREMEDRAFT_60625 predicted protein TREMEDRAFT_73390 similar to hypothetical protein CNE01250 TREMEDRAFT_67918 similar to hypothetical protein CNBE1210 TREMEDRAFT_43021 similar to hypothetical protein CNBE1250 TREMEDRAFT_60629 similar to hypothetical protein CNBE1120 TREMEDRAFT_27484 similar to conserved hypothetical protein TREMEDRAFT_60631 predicted protein TREMEDRAFT_60633 similar to hypothetical protein CNBE1270 TREMEDRAFT_27144 similar to hypothetical protein CaO19_12418 TREMEDRAFT_27662 similar to hypothetical protein CNE01280 TREMEDRAFT_28164 similar to hypothetical protein CNBE1140 TREMEDRAFT_67926 similar to hypothetical protein CNBE1220 TREMEDRAFT_27509 similar to hypothetical protein CNBE1490 TREMEDRAFT_67928 similar to hypothetical protein CNBE1300 TREMEDRAFT_60640 similar to hypothetical protein CNBE1290 TREMEDRAFT_60641 predicted protein TREMEDRAFT_60642 similar to transporter, putative TREMEDRAFT_71244 similar to hypothetical protein CNBE1000 TREMEDRAFT_60644 predicted protein TREMEDRAFT_22121 similar to nuclear segregation protein Bfr1, putative TREMEDRAFT_60646 similar to hypothetical protein CNE01070 TREMEDRAFT_27201 similar to endopolyphosphatase, putative TREMEDRAFT_60649 similar to hypothetical protein CNBC4070 TREMEDRAFT_67934 similar to hypothetical protein CNBE1090 TREMEDRAFT_28226 similar to hypothetical protein CNBE1070 TREMEDRAFT_38044 similar to predicted protein TREMEDRAFT_60652 predicted protein TREMEDRAFT_60653 predicted protein TREMEDRAFT_27920 similar to conserved hypothetical protein TREMEDRAFT_60656 similar to hypothetical protein CNBE1050 TREMEDRAFT_43042 similar to GTPase activating protein, putative TREMEDRAFT_60658 predicted protein TREMEDRAFT_60659 similar to hypothetical protein CNBE0750 TREMEDRAFT_60660 similar to hypothetical protein SNOG_05503 TREMEDRAFT_71251 similar to hypothetical protein CNBE0960 TREMEDRAFT_27197 similar to conserved hypothetical protein TREMEDRAFT_21225 similar to hypothetical protein CNBE0940 TREMEDRAFT_27343 similar to hypothetical protein CNBE0560 TREMEDRAFT_60666 predicted protein TREMEDRAFT_60667 predicted protein TREMEDRAFT_60669 predicted protein TREMEDRAFT_60671 predicted protein TREMEDRAFT_67947 similar to transcription factor, putative TREMEDRAFT_28068 similar to hypothetical protein CNBE0810 TREMEDRAFT_67950 similar to hypothetical protein CNBE0520 TREMEDRAFT_27919 similar to hypothetical protein CNBC3130 TREMEDRAFT_22967 similar to hypothetical protein CNBE0510 TREMEDRAFT_22144 similar to hypothetical protein CNBE0500 TREMEDRAFT_60678 similar to hypothetical protein CNBE0490 TREMEDRAFT_60679 predicted protein TREMEDRAFT_60680 predicted protein TREMEDRAFT_60681 similar to hypothetical protein CIMG_04839 TREMEDRAFT_27041 similar to hypothetical protein CC1G_08463 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_27576 similar to predicted protein TREMEDRAFT_60684 predicted protein TREMEDRAFT_27029 similar to hypothetical protein TREMEDRAFT_60687 predicted protein TREMEDRAFT_60688 predicted protein TREMEDRAFT_60689 predicted protein TREMEDRAFT_56534 expressed protein TREMEDRAFT_43061 similar to topoisomerase I TREMEDRAFT_60694 similar to hypothetical protein CNBH3770 TREMEDRAFT_67959 similar to hypothetical protein CNBH3760 TREMEDRAFT_60696 similar to conserved hypothetical protein TREMEDRAFT_22874 similar to hypothetical protein CNBH3010 TREMEDRAFT_60698 similar to hypothetical protein CNI03310 TREMEDRAFT_60699 predicted protein TREMEDRAFT_23848 similar to hypothetical protein CNBC3570 TREMEDRAFT_60701 predicted protein TREMEDRAFT_60702 predicted protein TREMEDRAFT_27018 similar to hypothetical protein CNBN1940 TREMEDRAFT_22089 similar to putative CENP-B/ARS binding protein-like protein TREMEDRAFT_60706 predicted protein TREMEDRAFT_60707 predicted protein TREMEDRAFT_67961 similar to hypothetical protein CNBH2970 TREMEDRAFT_43062 similar to hypothetical protein CNBH2980 TREMEDRAFT_67963 similar to hypothetical protein CNBI2680 TREMEDRAFT_60711 predicted protein TREMEDRAFT_27758 similar to hypothetical protein CNBL2430 TREMEDRAFT_27865 similar to hypothetical protein CNBH2940 TREMEDRAFT_27291 similar to hypothetical protein CNBH2610 TREMEDRAFT_27087 similar to hypothetical protein CNBH2960 TREMEDRAFT_27979 similar to hypothetical protein CNBH2590 TREMEDRAFT_60720 similar to hypothetical protein CNBH4060 TREMEDRAFT_60721 similar to hypothetical protein CNB01900 TREMEDRAFT_73410 similar to hypothetical protein CNI02760 TREMEDRAFT_60723 predicted protein TREMEDRAFT_60724 predicted protein TREMEDRAFT_60725 predicted protein TREMEDRAFT_60726 similar to unknown TREMEDRAFT_67967 similar to hypothetical protein CNBH4160 TREMEDRAFT_60728 predicted protein TREMEDRAFT_16819 similar to hypothetical protein CNBH4170 TREMEDRAFT_60731 predicted protein TREMEDRAFT_67971 similar to hypothetical protein CNBH4030 TREMEDRAFT_60733 predicted protein TREMEDRAFT_60734 predicted protein TREMEDRAFT_60735 predicted protein TREMEDRAFT_60737 predicted protein TREMEDRAFT_60738 predicted protein TREMEDRAFT_60739 predicted protein TREMEDRAFT_60741 predicted protein TREMEDRAFT_60742 predicted protein TREMEDRAFT_60743 predicted protein TREMEDRAFT_73413 similar to unknown; expressed hypothetical protein TREMEDRAFT_28347 similar to Rho guanyl-nucleotide exchange factor, putative TREMEDRAFT_14841 similar to unnamed protein product TREMEDRAFT_73414 similar to hypothetical protein CNBH2690 TREMEDRAFT_71263 similar to hypothetical protein CNBH4130 TREMEDRAFT_27687 similar to hypothetical protein CNBH4110 TREMEDRAFT_60752 predicted protein TREMEDRAFT_60753 predicted protein TREMEDRAFT_27449 similar to hypothetical protein CNBH2570 TREMEDRAFT_28366 similar to nuclear mRNA splicing protein TREMEDRAFT_67978 similar to hypothetical protein CNBH4080 TREMEDRAFT_60758 similar to predicted protein TREMEDRAFT_60759 similar to hypothetical protein CNBH4150 TREMEDRAFT_60761 similar to hypothetical protein CNBH4180 TREMEDRAFT_73420 similar to conserved hypothetical protein TREMEDRAFT_73421 predicted protein TREMEDRAFT_60765 similar to hypothetical protein CNBH2770 TREMEDRAFT_28267 similar to Protein phosphatase methylesterase 1 (PME-1) TREMEDRAFT_14150 similar to cAMP-dependent protein kinase catalytic subunit TREMEDRAFT_27049 similar to hypothetical protein TREMEDRAFT_60768 similar to Os04g0353200 TREMEDRAFT_60770 similar to hypothetical protein P3TCK_02064 TREMEDRAFT_60771 predicted protein TREMEDRAFT_60774 predicted protein TREMEDRAFT_23783 similar to hypothetical protein CNBE4050 TREMEDRAFT_60779 predicted protein TREMEDRAFT_38095 similar to TPA: TPA_inf: CAS33p TREMEDRAFT_60781 predicted protein TREMEDRAFT_60782 predicted protein TREMEDRAFT_60783 predicted protein TREMEDRAFT_27090 similar to hypothetical protein C03E10.2 - Caenorhabditis elegans TREMEDRAFT_60785 predicted protein TREMEDRAFT_60786 predicted protein TREMEDRAFT_60787 predicted protein TREMEDRAFT_27248 similar to predicted protein TREMEDRAFT_60789 predicted protein TREMEDRAFT_60790 predicted protein TREMEDRAFT_60791 predicted protein TREMEDRAFT_60792 predicted protein TREMEDRAFT_60793 predicted protein TREMEDRAFT_60794 predicted protein TREMEDRAFT_71272 expressed protein TREMEDRAFT_27426 similar to conserved hypothetical protein TREMEDRAFT_60797 predicted protein TREMEDRAFT_60798 similar to hypothetical protein CNI04420 TREMEDRAFT_27799 similar to hypothetical protein CNBH4210 TREMEDRAFT_43084 similar to hypothetical protein UM01121.1; expressed hypothetical protein TREMEDRAFT_27540 similar to hypothetical protein CNBB3880 TREMEDRAFT_60805 predicted protein TREMEDRAFT_60806 predicted protein TREMEDRAFT_27017 similar to hypothetical protein CC1G_12806 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_60808 predicted protein TREMEDRAFT_60809 predicted protein TREMEDRAFT_60810 predicted protein TREMEDRAFT_60812 similar to hypothetical protein CIMG_04839 TREMEDRAFT_67999 similar to hypothetical protein CNBH0340 TREMEDRAFT_43093 similar to Anthranilate synthase component 2 (Anthranilate synthase component II) [Includes: Glutamine amidotransferase TREMEDRAFT_60818 predicted protein TREMEDRAFT_71278 expressed protein TREMEDRAFT_29193 similar to hypothetical protein CNC04710 TREMEDRAFT_60822 similar to predicted protein TREMEDRAFT_60823 similar to predicted protein TREMEDRAFT_29014 similar to hypothetical protein CNBH0550 TREMEDRAFT_60825 similar to hypothetical protein CNBJ2400 TREMEDRAFT_60826 predicted protein TREMEDRAFT_29286 similar to hypothetical protein TREMEDRAFT_60829 similar to 3-hydroxyisobutyryl-CoA hydrolase, putative TREMEDRAFT_68006 similar to hypothetical protein CNBA2820 TREMEDRAFT_28700 similar to hypothetical protein CNBA2980 TREMEDRAFT_29293 similar to hypothetical protein CNA03070 TREMEDRAFT_60832 similar to predicted protein TREMEDRAFT_73434 expressed protein TREMEDRAFT_60834 predicted protein TREMEDRAFT_60835 predicted protein TREMEDRAFT_60836 predicted protein TREMEDRAFT_60837 predicted protein TREMEDRAFT_28693 similar to hypothetical protein CNBA2840 TREMEDRAFT_28985 similar to hypothetical protein CNBA6080 TREMEDRAFT_68010 similar to hypothetical protein CNBA2920 TREMEDRAFT_73435 similar to DNA repair-related protein, putative TREMEDRAFT_60842 predicted protein TREMEDRAFT_60843 predicted protein TREMEDRAFT_60847 predicted protein TREMEDRAFT_60848 predicted protein TREMEDRAFT_60850 similar to hypothetical protein TREMEDRAFT_28533 similar to hypothetical protein TREMEDRAFT_68014 similar to hypothetical protein CNBA2850 TREMEDRAFT_28684 similar to ubiquitin-protein ligase, putative TREMEDRAFT_28419 similar to hypothetical protein CNBA2990 TREMEDRAFT_43101 similar to hypothetical protein CNBA3000 TREMEDRAFT_68017 similar to hypothetical protein CNA03290 TREMEDRAFT_60857 predicted protein TREMEDRAFT_60859 predicted protein TREMEDRAFT_29235 similar to histone acetyltransferase (Gcn5), putative TREMEDRAFT_60861 predicted protein TREMEDRAFT_73438 similar to hypothetical protein CNBA3130 TREMEDRAFT_16281 similar to hst3 protein, putative TREMEDRAFT_60864 predicted protein TREMEDRAFT_73439 similar to hypothetical protein CNBA3020 TREMEDRAFT_28706 similar to hypothetical protein CNBA3010 TREMEDRAFT_60867 similar to hypothetical protein CNBA3180 TREMEDRAFT_60870 predicted protein TREMEDRAFT_60871 predicted protein TREMEDRAFT_60872 predicted protein TREMEDRAFT_60873 predicted protein TREMEDRAFT_60875 predicted protein TREMEDRAFT_60876 predicted protein TREMEDRAFT_60877 predicted protein TREMEDRAFT_73441 similar to hypothetical protein CNBA2590 TREMEDRAFT_15540 similar to hypothetical protein TREMEDRAFT_28696 similar to hypothetical protein CNBA3320 TREMEDRAFT_60881 predicted protein TREMEDRAFT_38121 similar to hypothetical protein CNBA3420 TREMEDRAFT_56556 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_60886 similar to hypothetical protein CNA02680 TREMEDRAFT_60887 similar to predicted protein TREMEDRAFT_60890 predicted protein TREMEDRAFT_28527 similar to CnHHK5 TREMEDRAFT_68029 similar to hypothetical protein CNBA3260 TREMEDRAFT_28730 similar to hypothetical protein CNBA3230 TREMEDRAFT_60894 similar to hypothetical protein CNBA3240 TREMEDRAFT_60895 similar to hypothetical protein CNBA2600 TREMEDRAFT_60898 similar to inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma TREMEDRAFT_43126 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_68035 similar to hypothetical protein CNBA3220 TREMEDRAFT_71288 similar to hypothetical protein TREMEDRAFT_28815 similar to hypothetical protein CNBA3210 TREMEDRAFT_68038 similar to hypothetical protein CNBA3280 TREMEDRAFT_60905 similar to conserved hypothetical protein TREMEDRAFT_29078 similar to hypothetical protein CNBA3370 TREMEDRAFT_28713 similar to hypothetical protein CNBA3380 TREMEDRAFT_29073 similar to hypothetical protein CNBA3390 TREMEDRAFT_15777 similar to hypothetical protein CNA03430 TREMEDRAFT_60910 predicted protein TREMEDRAFT_60912 predicted protein TREMEDRAFT_68045 similar to hypothetical protein CNBA2630 TREMEDRAFT_68048 similar to NADPH oxidase A TREMEDRAFT_73458 similar to hypothetical protein CNBA3080 TREMEDRAFT_60923 similar to hypothetical protein CNA03140 TREMEDRAFT_60924 similar to hypothetical protein CNA03150 TREMEDRAFT_43154 similar to hypothetical protein CNBA3470 TREMEDRAFT_56579 expressed protein TREMEDRAFT_18663 similar to hypothetical protein CNBI2540 TREMEDRAFT_60930 similar to predicted protein TREMEDRAFT_29190 similar to hypothetical protein CNBI2580 TREMEDRAFT_71303 similar to hypothetical protein CNL04300 TREMEDRAFT_60936 similar to hypothetical protein CHGG_02414 TREMEDRAFT_60938 predicted protein TREMEDRAFT_60939 predicted protein TREMEDRAFT_60942 similar to gag TREMEDRAFT_60943 similar to hypothetical protein CNBB2760 TREMEDRAFT_60951 predicted protein TREMEDRAFT_73469 similar to cAMP dependent protein kinase catalytic subunit; expressed hypothetical protein TREMEDRAFT_43173 similar to DESR1, putative; expressed hypothetical protein TREMEDRAFT_60956 similar to hypothetical protein CNBF0630 TREMEDRAFT_29051 similar to pyruvate dehydrogenase (acetyl-transferring), putative TREMEDRAFT_43180 similar to hypothetical protein CNBI2410 TREMEDRAFT_38204 similar to AY086643 putativepod-specific dehydrogenase SAC25, putative TREMEDRAFT_73476 similar to TPA: TPA_inf: CAS32p; expressed hypothetical protein TREMEDRAFT_60962 similar to hypothetical protein HCAG_08530 TREMEDRAFT_68071 similar to hypothetical protein CNBI2560 TREMEDRAFT_29091 similar to predicted protein TREMEDRAFT_60965 predicted protein TREMEDRAFT_71310 similar to hypothetical protein CNBI2310 TREMEDRAFT_38213 similar to hypothetical protein CNBI2470 TREMEDRAFT_73480 Putative wc-1 TREMEDRAFT_73481 similar to hypothetical protein CNBI2400 TREMEDRAFT_68076 similar to actin filament organization-related protein, putative TREMEDRAFT_60973 predicted protein TREMEDRAFT_29287 similar to hypothetical protein CNL04410 TREMEDRAFT_29248 similar to hypothetical protein CNBI2360 TREMEDRAFT_68079 similar to hypothetical protein CNBI2350 TREMEDRAFT_73483 similar to hypothetical protein CNBI2440 TREMEDRAFT_28462 similar to hypothetical protein CNL04380 TREMEDRAFT_60980 similar to hypothetical protein CNBI2320 TREMEDRAFT_43206 similar to hypothetical protein CNBI1870 TREMEDRAFT_60985 predicted protein TREMEDRAFT_60986 predicted protein TREMEDRAFT_60987 similar to hypothetical protein CNBI1620 TREMEDRAFT_20323 similar to predicted protein TREMEDRAFT_29037 similar to hypothetical protein CNBI1570 TREMEDRAFT_60990 predicted protein TREMEDRAFT_60991 similar to hypothetical protein CIMG_04839 TREMEDRAFT_60993 predicted protein TREMEDRAFT_43212 similar to Eukaryotic translation initiation factor 3 subunit 6, putative; expressed hypothetical protein TREMEDRAFT_60995 similar to hypothetical protein SS1G_00010 TREMEDRAFT_43215 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_60997 similar to hypothetical protein TREMEDRAFT_60998 predicted protein TREMEDRAFT_60999 similar to hypothetical protein CNBI1780 TREMEDRAFT_29212 similar to predicted protein TREMEDRAFT_73490 similar to exo-beta-1,3-glucanase; expressed hypothetical protein TREMEDRAFT_68093 similar to hypothetical protein CNBI2140 TREMEDRAFT_61003 similar to hypothetical protein CIMG_04839 TREMEDRAFT_61005 predicted protein TREMEDRAFT_61006 predicted protein TREMEDRAFT_61007 predicted protein TREMEDRAFT_61008 predicted protein TREMEDRAFT_61009 predicted protein TREMEDRAFT_43224 similar to hypothetical protein CNBI1970 TREMEDRAFT_68095 similar to conserved hypothetical protein TREMEDRAFT_28934 similar to hypothetical protein CNBI1920 TREMEDRAFT_23472 similar to predicted protein TREMEDRAFT_68096 expressed protein TREMEDRAFT_29053 similar to hypothetical protein CNL04940 TREMEDRAFT_19210 similar to cytochrome c oxidase polypeptide IV mitochondrial precursor; expressed hypothetical protein TREMEDRAFT_71323 expressed protein TREMEDRAFT_61018 predicted protein TREMEDRAFT_61019 similar to hypothetical protein CNBI2150 TREMEDRAFT_56612 similar to carbonic anhydrase 2; expressed hypothetical protein TREMEDRAFT_61023 predicted protein TREMEDRAFT_61025 predicted protein TREMEDRAFT_61027 predicted protein TREMEDRAFT_61028 predicted protein TREMEDRAFT_61029 similar to predicted protein TREMEDRAFT_61030 predicted protein TREMEDRAFT_61031 predicted protein TREMEDRAFT_61033 similar to hypothetical protein CIMG_04839 TREMEDRAFT_61034 predicted protein TREMEDRAFT_61035 predicted protein TREMEDRAFT_61036 predicted protein TREMEDRAFT_61038 predicted protein TREMEDRAFT_22759 similar to predicted protein TREMEDRAFT_61040 predicted protein TREMEDRAFT_61041 predicted protein TREMEDRAFT_73499 similar to hypothetical protein CNBI2030 TREMEDRAFT_68105 similar to alpha-1,3-mannosyltransferase, putative; expressed hypothetical protein TREMEDRAFT_61044 predicted protein TREMEDRAFT_61046 predicted protein TREMEDRAFT_61048 similar to hypothetical protein CIMG_04839 TREMEDRAFT_61050 predicted protein TREMEDRAFT_61051 similar to agCP7521-like protein TREMEDRAFT_61052 predicted protein TREMEDRAFT_61053 predicted protein TREMEDRAFT_61054 predicted protein TREMEDRAFT_61055 predicted protein TREMEDRAFT_61056 similar to hypothetical protein CNBI2130 TREMEDRAFT_43245 similar to hypothetical protein CNBI2120 TREMEDRAFT_56616 similar to protoheme IX farnesyltransferase, putative; expressed hypothetical protein TREMEDRAFT_73502 similar to hypothetical protein CNBI2170 TREMEDRAFT_61059 predicted protein TREMEDRAFT_56617 expressed protein TREMEDRAFT_73503 predicted protein TREMEDRAFT_11403 similar to hypothetical protein CNBI2250 TREMEDRAFT_68109 similar to hypothetical protein CNBI2240 TREMEDRAFT_61064 predicted protein TREMEDRAFT_73505 expressed protein TREMEDRAFT_73506 expressed protein TREMEDRAFT_43253 similar to TPA: TPA_inf: Cap3p; expressed hypothetical protein TREMEDRAFT_29252 similar to hypothetical protein CNBI2080 TREMEDRAFT_43259 similar to hypothetical protein CNBI2220 TREMEDRAFT_61071 similar to hypothetical protein CNA05720 TREMEDRAFT_28579 similar to hypothetical protein CNBH0690 TREMEDRAFT_61073 predicted protein TREMEDRAFT_68115 similar to predicted protein TREMEDRAFT_61075 similar to hypothetical protein CNC00420 TREMEDRAFT_29065 similar to hypothetical protein CNBH0420 TREMEDRAFT_61077 similar to hypothetical protein CNBH0430 TREMEDRAFT_61078 similar to aminotransferase, putative TREMEDRAFT_56621 expressed protein TREMEDRAFT_68118 similar to NADPH oxidase regulator NoxR TREMEDRAFT_61080 predicted protein TREMEDRAFT_61082 similar to hypothetical protein CNI00500 TREMEDRAFT_61083 similar to hypothetical protein CNI00500 TREMEDRAFT_29041 similar to hypothetical protein CNBH0360 TREMEDRAFT_68121 similar to hypothetical protein DEHA0G20735g TREMEDRAFT_29121 similar to hypothetical protein CNG01680 TREMEDRAFT_61087 similar to hypothetical protein CNBH0500 TREMEDRAFT_43264 similar to hypothetical protein CNBH0380 TREMEDRAFT_61091 predicted protein TREMEDRAFT_61092 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_43268 similar to hypothetical protein FG02148.1; expressed hypothetical protein TREMEDRAFT_61095 predicted protein TREMEDRAFT_61096 predicted protein TREMEDRAFT_16198 similar to hypothetical protein CNBC6850 TREMEDRAFT_61098 similar to hypothetical protein CNK01610 TREMEDRAFT_14638 similar to hypothetical protein CNBD1730 TREMEDRAFT_61100 similar to conserved hypothetical protein TREMEDRAFT_18354 similar to hypothetical protein TREMEDRAFT_61103 predicted protein TREMEDRAFT_61104 predicted protein TREMEDRAFT_61105 predicted protein TREMEDRAFT_61106 predicted protein TREMEDRAFT_22236 similar to predicted protein TREMEDRAFT_28694 similar to negative regulator of gluconeogenesis TREMEDRAFT_28929 similar to carboxyl-terminal proteinase, putative TREMEDRAFT_13756 similar to cleavage/polyadenylation specificity factor, putative TREMEDRAFT_61113 similar to hypothetical protein CNBA1430 TREMEDRAFT_28436 similar to conserved hypothetical protein TREMEDRAFT_61115 predicted protein TREMEDRAFT_28860 similar to Alternative oxidase, mitochondrial precursor; expressed hypothetical protein TREMEDRAFT_61120 predicted protein TREMEDRAFT_28995 similar to Ras-like protein precursor TREMEDRAFT_61122 similar to hypothetical protein CNBA1970 TREMEDRAFT_61124 predicted protein TREMEDRAFT_61126 similar to hypothetical protein CIMG_04839 TREMEDRAFT_23673 similar to hypothetical protein TREMEDRAFT_61129 similar to hypothetical protein CNBA1920 TREMEDRAFT_28951 similar to hypothetical protein CNJ02120 TREMEDRAFT_68135 similar to peroxisome assembly protein, putative TREMEDRAFT_28893 similar to hypothetical protein TREMEDRAFT_29143 similar to hypothetical protein CNA01570 TREMEDRAFT_68137 similar to hypothetical protein CNBA1500 TREMEDRAFT_61136 predicted protein TREMEDRAFT_29209 similar to hypothetical protein TREMEDRAFT_43282 similar to zinc-finger protein zpr1, putative TREMEDRAFT_28887 similar to hypothetical protein CNBA2640 TREMEDRAFT_28666 similar to hypothetical protein TREMEDRAFT_61141 predicted protein TREMEDRAFT_61142 predicted protein TREMEDRAFT_61144 similar to hypothetical protein CHGG_03403 TREMEDRAFT_61145 predicted protein TREMEDRAFT_68144 similar to hypothetical protein BC1G_05208 TREMEDRAFT_28847 similar to hypothetical protein CNBC3020 TREMEDRAFT_68146 similar to hypothetical protein CC1G_04300 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_71343 expressed protein TREMEDRAFT_61153 predicted protein TREMEDRAFT_61154 predicted protein TREMEDRAFT_61155 similar to hypothetical protein CNBC1040 TREMEDRAFT_73531 similar to hypothetical protein CNBA2470 TREMEDRAFT_29057 similar to hypothetical protein CNBA2810 TREMEDRAFT_68157 similar to hypothetical protein TREMEDRAFT_20317 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_28776 similar to endoplasmic reticulum protein, putative TREMEDRAFT_68158 similar to hypothetical protein CNBA1710 TREMEDRAFT_61166 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_28996 similar to hypothetical protein CNBA1600 TREMEDRAFT_61168 similar to hypothetical protein CNBA1540 TREMEDRAFT_61169 similar to conserved hypothetical protein TREMEDRAFT_28922 similar to hypothetical protein CNBA1580 TREMEDRAFT_61171 similar to hypothetical protein TREMEDRAFT_61172 similar to hypothetical protein CNBA1560 TREMEDRAFT_61173 predicted protein TREMEDRAFT_61174 similar to conserved hypothetical protein TREMEDRAFT_61175 predicted protein TREMEDRAFT_73534 similar to hypothetical protein CNBM1360 TREMEDRAFT_61177 similar to hypothetical protein TREMEDRAFT_61178 predicted protein TREMEDRAFT_73535 similar to oxidoreductase, putative; expressed hypothetical protein TREMEDRAFT_61180 similar to hypothetical protein CNA02080 TREMEDRAFT_61181 similar to vesicle-associated membrane protein 712, putative TREMEDRAFT_68167 similar to hypothetical protein CNA02130 TREMEDRAFT_29049 similar to conserved hypothetical protein TREMEDRAFT_28718 similar to hypothetical protein CNE04110 TREMEDRAFT_61186 predicted protein TREMEDRAFT_61187 predicted protein TREMEDRAFT_61188 predicted protein TREMEDRAFT_61190 predicted protein TREMEDRAFT_24071 similar to hypothetical protein BMA10247_A2353 TREMEDRAFT_61191 predicted protein TREMEDRAFT_61192 predicted protein TREMEDRAFT_61195 predicted protein TREMEDRAFT_61196 predicted protein TREMEDRAFT_61197 predicted protein TREMEDRAFT_61198 predicted protein TREMEDRAFT_61200 similar to hypothetical protein CIMG_04839 TREMEDRAFT_61202 predicted protein TREMEDRAFT_68170 similar to peroxisome organization and biogenesis-related protein, putative TREMEDRAFT_68173 similar to conserved hypothetical protein TREMEDRAFT_24181 similar to chaperone, putative TREMEDRAFT_28490 similar to hypothetical protein CNBA2780 TREMEDRAFT_29255 similar to hypothetical protein CNBA2210 TREMEDRAFT_56642 expressed protein TREMEDRAFT_61213 similar to hypothetical protein TREMEDRAFT_61215 similar to hypothetical protein CNA02310 TREMEDRAFT_28670 similar to conserved hypothetical protein TREMEDRAFT_68179 similar to hypothetical protein CNA02820 TREMEDRAFT_61218 predicted protein TREMEDRAFT_71360 similar to gamma-tubulin complex component 2 (gcp-2), putative TREMEDRAFT_61220 predicted protein TREMEDRAFT_61221 predicted protein TREMEDRAFT_61223 predicted protein TREMEDRAFT_61224 similar to hypothetical protein CNH00910 TREMEDRAFT_61226 similar to hypothetical protein CNBA2170 TREMEDRAFT_61227 predicted protein TREMEDRAFT_61228 similar to hypothetical protein CNBA2180 TREMEDRAFT_68182 similar to Ras guanyl-nucleotide exchange factor, putative TREMEDRAFT_38360 similar to chaperone activator, putative; expressed hypothetical protein TREMEDRAFT_61230 predicted protein TREMEDRAFT_28786 similar to hypothetical protein CNBA2320 TREMEDRAFT_43333 similar to hypothetical protein CNBA2310 TREMEDRAFT_28516 similar to conserved hypothetical protein TREMEDRAFT_68186 similar to hypothetical protein CNBA2380 TREMEDRAFT_61235 predicted protein TREMEDRAFT_29122 similar to hypothetical protein CNBA2440 TREMEDRAFT_61238 similar to hypothetical protein CNBA2150 TREMEDRAFT_61239 predicted protein TREMEDRAFT_43337 similar to hypothetical protein CNBA2720 TREMEDRAFT_28865 similar to hypothetical protein CNBA2710 TREMEDRAFT_61243 predicted protein TREMEDRAFT_61244 similar to hypothetical protein CNA02440 TREMEDRAFT_61245 predicted protein TREMEDRAFT_29093 similar to conserved hypothetical protein TREMEDRAFT_56647 expressed protein TREMEDRAFT_71365 expressed protein TREMEDRAFT_56649 expressed protein TREMEDRAFT_61250 predicted protein TREMEDRAFT_28912 similar to hypothetical protein CNBA2360 TREMEDRAFT_73550 predicted protein TREMEDRAFT_28739 similar to predicted protein TREMEDRAFT_71371 similar to rsec15, putative TREMEDRAFT_28955 similar to Vacuolar ATP synthase subunit e (V-ATPase subunit e) (Vacuolar proton pump subunit e) TREMEDRAFT_61255 predicted protein TREMEDRAFT_61256 predicted protein TREMEDRAFT_61257 predicted protein TREMEDRAFT_28746 similar to hypothetical protein CNBA2250 TREMEDRAFT_28751 similar to hypothetical protein CNBA2260 TREMEDRAFT_61259 similar to hypothetical protein CNBA1770 TREMEDRAFT_61261 similar to hypothetical protein TREMEDRAFT_43354 similar to gamma-adaptin, putative; expressed hypothetical protein TREMEDRAFT_38385 similar to hypothetical protein CNBA1790 TREMEDRAFT_61264 predicted protein TREMEDRAFT_61265 similar to hypothetical protein CNBA1740 TREMEDRAFT_73557 similar to transcriptional activator, putative TREMEDRAFT_61267 predicted protein TREMEDRAFT_61268 predicted protein TREMEDRAFT_61269 predicted protein TREMEDRAFT_61270 similar to hypothetical protein CNBA0500 TREMEDRAFT_43359 similar to hypothetical protein CNBA1720 TREMEDRAFT_29086 similar to hypothetical protein CNBA1880 TREMEDRAFT_19508 similar to hypothetical protein CNA01940 TREMEDRAFT_68208 similar to cactin, putative TREMEDRAFT_68209 similar to hypothetical protein TREMEDRAFT_17923 similar to hypothetical protein TREMEDRAFT_68211 similar to cytoplasm protein, putative TREMEDRAFT_61281 similar to hypothetical protein CNBA1960 TREMEDRAFT_38393 similar to ferric reductase transmembrane component, putative; expressed hypothetical protein TREMEDRAFT_68214 similar to hypothetical protein CNBA1940 TREMEDRAFT_71381 similar to hypothetical protein CNBA1910 TREMEDRAFT_68217 similar to hypothetical protein CNBA1900 TREMEDRAFT_71382 similar to hypothetical protein CNBA1180 TREMEDRAFT_61287 predicted protein TREMEDRAFT_68219 similar to hypothetical protein CNBA0390 TREMEDRAFT_11397 similar to hypothetical protein CNBA0550 TREMEDRAFT_61290 similar to hypothetical protein CNBA1230 TREMEDRAFT_68222 similar to hypothetical protein CNA01320 TREMEDRAFT_43367 similar to phosphoribosylamidoimidazole-succinocarboxamide synthase, putative; expressed hypothetical protein TREMEDRAFT_68225 similar to hypothetical protein CNBA1340 TREMEDRAFT_61295 similar to hypothetical protein CNBA1320 TREMEDRAFT_61296 predicted protein TREMEDRAFT_68226 similar to rRNA processing-related protein, putative TREMEDRAFT_61299 predicted protein TREMEDRAFT_73567 similar to U1 snRNP 70K protein (short form), putative; expressed hypothetical protein TREMEDRAFT_61302 similar to hypothetical protein CNBA1190 TREMEDRAFT_28920 similar to hypothetical protein CNBA1210 TREMEDRAFT_61306 predicted protein TREMEDRAFT_61307 predicted protein TREMEDRAFT_61309 predicted protein TREMEDRAFT_61310 predicted protein TREMEDRAFT_61311 predicted protein TREMEDRAFT_61312 predicted protein TREMEDRAFT_28632 similar to predicted protein TREMEDRAFT_18027 similar to hypothetical protein CNBA0150 TREMEDRAFT_56671 expressed protein TREMEDRAFT_61316 similar to Putative RNA polymerase II transcriptional coactivator TREMEDRAFT_61319 predicted protein TREMEDRAFT_61320 predicted protein TREMEDRAFT_61321 predicted protein TREMEDRAFT_61323 similar to hypothetical protein CNBA1050 TREMEDRAFT_61324 predicted protein TREMEDRAFT_28772 similar to predicted protein TREMEDRAFT_61326 similar to alkylated DNA repair protein TREMEDRAFT_28825 similar to hypothetical protein CNBA0410 TREMEDRAFT_61327 predicted protein TREMEDRAFT_61328 similar to A/G-specific adenine DNA glycosylase, putative TREMEDRAFT_61329 similar to hypothetical protein CNBA1130 TREMEDRAFT_28636 similar to hypothetical protein CNBA1070 TREMEDRAFT_29211 similar to hypothetical protein CNBA0750 TREMEDRAFT_73574 similar to retinitis pigmentosa GTPase regulator-like protein; expressed hypothetical protein TREMEDRAFT_61332 predicted protein TREMEDRAFT_61333 similar to hypothetical protein CNBA0440 TREMEDRAFT_61334 predicted protein TREMEDRAFT_61335 predicted protein TREMEDRAFT_61336 predicted protein TREMEDRAFT_61337 predicted protein TREMEDRAFT_61338 predicted protein TREMEDRAFT_61339 predicted protein TREMEDRAFT_61340 predicted protein TREMEDRAFT_61341 predicted protein TREMEDRAFT_61342 predicted protein TREMEDRAFT_61345 predicted protein TREMEDRAFT_28837 similar to hypothetical protein CNBF1830 TREMEDRAFT_61350 predicted protein TREMEDRAFT_38419 similar to hypothetical protein CNBA0700 TREMEDRAFT_68241 similar to hypothetical protein CNBA0740 TREMEDRAFT_28999 similar to hypothetical protein CNBA0720 TREMEDRAFT_56674 similar to SJCHGC06573 protein; expressed hypothetical protein TREMEDRAFT_56675 expressed protein TREMEDRAFT_61358 predicted protein TREMEDRAFT_61359 similar to hypothetical protein CNBA0630 TREMEDRAFT_61361 predicted protein TREMEDRAFT_29061 similar to hypothetical protein CNBA0630 TREMEDRAFT_28974 similar to hypothetical protein CNBA0310 TREMEDRAFT_61363 predicted protein TREMEDRAFT_61364 similar to hypothetical protein FG02861.1 TREMEDRAFT_71395 similar to hypothetical protein CNBA0660 TREMEDRAFT_71396 similar to conserved hypothetical protein TREMEDRAFT_19193 similar to hypothetical protein CNBA0530 TREMEDRAFT_73580 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_61370 predicted protein TREMEDRAFT_61372 similar to hypothetical protein CNBA0570 TREMEDRAFT_61373 predicted protein TREMEDRAFT_68249 similar to hypothetical protein CNBA0330 TREMEDRAFT_68250 similar to hypothetical protein CNBA0480 TREMEDRAFT_61376 similar to predicted protein TREMEDRAFT_28753 similar to glycoside hydrolase family 16 protein TREMEDRAFT_28582 similar to hypothetical protein CNBA0770 TREMEDRAFT_29019 similar to hypothetical protein CNBA0780 TREMEDRAFT_61384 similar to hypothetical protein MGL_4148 TREMEDRAFT_29267 similar to conserved hypothetical protein TREMEDRAFT_61388 similar to hypothetical protein CNBA0100 TREMEDRAFT_43427 similar to hypothetical protein CNBA0920 TREMEDRAFT_29315 similar to hypothetical protein CNBL1840 TREMEDRAFT_61393 predicted protein TREMEDRAFT_61394 predicted protein TREMEDRAFT_61395 predicted protein TREMEDRAFT_61397 predicted protein TREMEDRAFT_29277 similar to hypothetical protein CNBA0610 TREMEDRAFT_29308 similar to Protein PNS1 TREMEDRAFT_43432 similar to methionine-tRNA ligase, putative TREMEDRAFT_29158 similar to hypothetical protein CC1G_10275 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_18693 similar to unnamed protein product TREMEDRAFT_68268 similar to cell cycle arrest in response to pheromone-related protein, putative TREMEDRAFT_28522 similar to hypothetical protein CC1G_05134 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_61405 predicted protein TREMEDRAFT_71409 expressed protein TREMEDRAFT_61407 predicted protein TREMEDRAFT_61408 similar to topoisomerase acting in meiosis TREMEDRAFT_61410 similar to hypothetical protein SS1G_00515 TREMEDRAFT_61411 similar to hypothetical protein CNBA0790 TREMEDRAFT_61412 predicted protein TREMEDRAFT_73595 expressed protein TREMEDRAFT_28866 similar to hypothetical protein CNBF0430 TREMEDRAFT_61417 predicted protein TREMEDRAFT_61418 predicted protein TREMEDRAFT_29328 similar to hypothetical protein CNBD2820 TREMEDRAFT_56693 expressed protein TREMEDRAFT_43446 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_29011 similar to hypothetical protein TREMEDRAFT_73600 similar to hypothetical protein CNBA0990 TREMEDRAFT_29066 similar to hypothetical protein CNBA0850 TREMEDRAFT_29291 similar to hypothetical protein CNBA1000 TREMEDRAFT_73601 similar to hypothetical protein CNBA0940 TREMEDRAFT_68281 similar to hypothetical protein CNBA0840 TREMEDRAFT_61430 similar to hypothetical protein CNA05720 TREMEDRAFT_61431 similar to hypothetical protein CNA05720 TREMEDRAFT_61432 predicted protein TREMEDRAFT_61433 predicted protein TREMEDRAFT_61435 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_28420 similar to hypothetical protein CNBD2850 TREMEDRAFT_21645 similar to predicted protein TREMEDRAFT_61441 predicted protein TREMEDRAFT_61442 predicted protein TREMEDRAFT_61443 predicted protein TREMEDRAFT_61444 predicted protein TREMEDRAFT_61446 predicted protein TREMEDRAFT_61447 predicted protein TREMEDRAFT_29260 similar to hypothetical protein CNBA0860 TREMEDRAFT_61452 predicted protein TREMEDRAFT_61453 similar to serine-proline rich repeat protein TREMEDRAFT_61455 predicted protein TREMEDRAFT_61456 predicted protein TREMEDRAFT_61457 predicted protein TREMEDRAFT_61458 similar to hypothetical protein CNBL1840 TREMEDRAFT_61459 predicted protein TREMEDRAFT_61461 predicted protein TREMEDRAFT_28850 similar to calcium ion transporter, putative TREMEDRAFT_61465 similar to foxi one TREMEDRAFT_28447 similar to hypothetical protein CNBL1840 TREMEDRAFT_61467 predicted protein TREMEDRAFT_61469 similar to predicted protein TREMEDRAFT_61471 similar to predicted protein TREMEDRAFT_61472 predicted protein TREMEDRAFT_61473 predicted protein TREMEDRAFT_61474 predicted protein TREMEDRAFT_61476 predicted protein TREMEDRAFT_61477 similar to predicted protein TREMEDRAFT_29854 similar to conserved hypothetical protein TREMEDRAFT_61480 predicted protein TREMEDRAFT_61481 predicted protein TREMEDRAFT_61482 predicted protein TREMEDRAFT_18055 similar to hypothetical protein CC1G_11959 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_61485 similar to hypothetical protein CC1G_13158 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_30319 similar to hypothetical protein CC1G_11011 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_61487 predicted protein TREMEDRAFT_61489 predicted protein TREMEDRAFT_61490 predicted protein TREMEDRAFT_61492 similar to Os04g0353200 TREMEDRAFT_61494 predicted protein TREMEDRAFT_61495 predicted protein TREMEDRAFT_29816 similar to hypothetical protein CNBE0320 TREMEDRAFT_61497 similar to hypothetical protein PY06017 TREMEDRAFT_68294 similar to CAP64 gene product - related TREMEDRAFT_61499 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_38501 similar to hypothetical protein CNBG4080 TREMEDRAFT_73612 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_29688 similar to predicted protein TREMEDRAFT_29434 similar to hypothetical protein CNBA6620 TREMEDRAFT_61505 predicted protein TREMEDRAFT_61506 similar to hypothetical protein CNBJ1920 TREMEDRAFT_61507 similar to hypothetical protein CNBB5260 TREMEDRAFT_61508 predicted protein TREMEDRAFT_61510 predicted protein TREMEDRAFT_30295 similar to predicted protein TREMEDRAFT_61513 predicted protein TREMEDRAFT_61514 predicted protein TREMEDRAFT_61515 predicted protein TREMEDRAFT_61516 predicted protein TREMEDRAFT_61517 predicted protein TREMEDRAFT_23063 similar to predicted protein TREMEDRAFT_61520 similar to microfilarial sheath protein SHP3 TREMEDRAFT_61521 predicted protein TREMEDRAFT_61522 predicted protein TREMEDRAFT_61523 predicted protein TREMEDRAFT_61524 predicted protein TREMEDRAFT_61525 predicted protein TREMEDRAFT_61526 predicted protein TREMEDRAFT_61527 predicted protein TREMEDRAFT_61529 predicted protein TREMEDRAFT_61530 predicted protein TREMEDRAFT_29541 similar to hypothetical protein CNBA6700 TREMEDRAFT_61532 predicted protein TREMEDRAFT_61533 similar to hypothetical protein CNA05900 TREMEDRAFT_61537 predicted protein TREMEDRAFT_61538 similar to hypothetical protein CNA07970 TREMEDRAFT_30301 similar to hypothetical protein CNBA7790 TREMEDRAFT_61539 predicted protein TREMEDRAFT_61541 predicted protein TREMEDRAFT_61543 predicted protein TREMEDRAFT_61544 predicted protein TREMEDRAFT_29364 similar to hypothetical protein TREMEDRAFT_30156 similar to conserved hypothetical protein TREMEDRAFT_68302 predicted protein TREMEDRAFT_61546 predicted protein TREMEDRAFT_61547 predicted protein TREMEDRAFT_61549 predicted protein TREMEDRAFT_61551 predicted protein TREMEDRAFT_61552 similar to hypothetical protein CIMG_04839 TREMEDRAFT_61554 predicted protein TREMEDRAFT_61555 predicted protein TREMEDRAFT_61556 predicted protein TREMEDRAFT_61557 predicted protein TREMEDRAFT_73617 predicted protein TREMEDRAFT_29770 similar to hypothetical protein CC1G_02945 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_29872 similar to predicted protein TREMEDRAFT_68303 similar to hypothetical protein CNBA6680 TREMEDRAFT_29778 similar to oxidoreductase, zinc-binding dehydrogenase family superfamily TREMEDRAFT_29813 similar to hypothetical protein CNBA6670 TREMEDRAFT_73618 similar to ubiquitin-protein ligase, putative TREMEDRAFT_29417 similar to predicted protein TREMEDRAFT_61565 predicted protein TREMEDRAFT_17798 similar to predicted protein TREMEDRAFT_21012 similar to methylcrotonoyl-Coenzyme A carboxylase 1 (alpha), isoform CRA_a TREMEDRAFT_43487 similar to glycosyltransferase family 32 protein TREMEDRAFT_11871 similar to potassium transport protein, high-affinity, putative TREMEDRAFT_61573 predicted protein TREMEDRAFT_61575 predicted protein TREMEDRAFT_61577 predicted protein TREMEDRAFT_61578 predicted protein TREMEDRAFT_61579 predicted protein TREMEDRAFT_38519 similar to hypothetical protein CNBA6450 TREMEDRAFT_61581 similar to hypothetical protein CC1G_05847 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_61582 similar to hypothetical protein TREMEDRAFT_30239 similar to hypothetical protein CNBA6460 TREMEDRAFT_61584 predicted protein TREMEDRAFT_29749 similar to predicted protein TREMEDRAFT_43495 similar to hypothetical protein CNBA6560 TREMEDRAFT_12156 similar to hypothetical protein CNA07320 TREMEDRAFT_73626 similar to UDP-glucose epimerase; expressed hypothetical protein TREMEDRAFT_30138 similar to capsular associated protein TREMEDRAFT_68316 similar to hypothetical protein CNBA7610 TREMEDRAFT_61592 predicted protein TREMEDRAFT_11835 similar to hypothetical protein CNBA7190 TREMEDRAFT_30214 similar to hypothetical protein CNBA7180 TREMEDRAFT_17930 similar to hypothetical protein CNBA7170 TREMEDRAFT_61596 similar to hypothetical protein CNA07340 TREMEDRAFT_61598 similar to ATP-binding cassette sub-family E member 1 (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I) TREMEDRAFT_61600 similar to hypothetical protein CNBA6940 TREMEDRAFT_61601 similar to hypothetical protein CNBA6830 TREMEDRAFT_30115 similar to hypothetical protein CNBA6870 TREMEDRAFT_43509 similar to hypothetical protein CNA07800 TREMEDRAFT_30305 similar to hypothetical protein CNA07420 TREMEDRAFT_61605 predicted protein TREMEDRAFT_43510 similar to hypothetical protein CNBA7270 TREMEDRAFT_29971 similar to hypothetical protein CNBA6840 TREMEDRAFT_13217 similar to hypothetical protein CNBA6880 TREMEDRAFT_61609 similar to hypothetical protein CNBA7490 TREMEDRAFT_61610 similar to hypothetical protein DDBDRAFT_0188381 TREMEDRAFT_61611 predicted protein TREMEDRAFT_61612 predicted protein TREMEDRAFT_61613 predicted protein TREMEDRAFT_61614 predicted protein TREMEDRAFT_61615 predicted protein TREMEDRAFT_61617 similar to predicted protein TREMEDRAFT_61618 similar to hypothetical protein CNBM0210 TREMEDRAFT_61620 predicted protein TREMEDRAFT_61621 predicted protein TREMEDRAFT_61622 predicted protein TREMEDRAFT_61623 predicted protein TREMEDRAFT_61624 similar to hypothetical protein CNBA7650 TREMEDRAFT_29389 similar to conserved hypothetical protein TREMEDRAFT_29921 similar to hypothetical protein CNBA7230 TREMEDRAFT_73636 similar to hypothetical protein TREMEDRAFT_61630 predicted protein TREMEDRAFT_73637 predicted protein TREMEDRAFT_43516 similar to hypothetical protein CNBA7700 TREMEDRAFT_61634 similar to hypothetical protein CYA_0587 TREMEDRAFT_68333 similar to efflux protein EncT, putative TREMEDRAFT_61638 predicted protein TREMEDRAFT_68337 similar to hypothetical protein CNBA7070 TREMEDRAFT_29687 similar to hypothetical protein CNBA6950 TREMEDRAFT_73643 similar to CAP64 gene product - related; expressed hypothetical protein TREMEDRAFT_61644 similar to unnamed protein product TREMEDRAFT_68341 similar to hypothetical protein CNBA7730 TREMEDRAFT_73644 similar to hypothetical protein CNBA7770 TREMEDRAFT_68343 similar to hypothetical protein CNBA7970 TREMEDRAFT_61649 similar to predicted protein TREMEDRAFT_61650 similar to hypothetical protein CNBA8130 TREMEDRAFT_61651 predicted protein TREMEDRAFT_23568 similar to predicted protein TREMEDRAFT_73645 similar to hypothetical protein CNBA7020 TREMEDRAFT_61654 similar to hypothetical protein CNBA7010 TREMEDRAFT_30233 similar to conserved hypothetical protein TREMEDRAFT_61656 predicted protein TREMEDRAFT_61657 similar to hypothetical protein CNBA7030 TREMEDRAFT_73646 similar to hypothetical protein CNBA7780 TREMEDRAFT_61659 similar to conserved hypothetical protein TREMEDRAFT_73649 similar to hypothetical protein CNBA6990 TREMEDRAFT_43544 similar to hypothetical protein CNBA7570 TREMEDRAFT_61665 predicted protein TREMEDRAFT_61666 similar to cytoplasm protein, putative TREMEDRAFT_29601 similar to hypothetical protein CNBA5850 TREMEDRAFT_29831 similar to hypothetical protein CNA06080 TREMEDRAFT_61669 similar to specific transcriptional repressor, putative TREMEDRAFT_73653 similar to hypothetical protein CNBA5900 TREMEDRAFT_71446 similar to hypothetical protein CNBA5920 TREMEDRAFT_61673 predicted protein TREMEDRAFT_30271 similar to hypothetical protein TREMEDRAFT_71447 similar to carnitine/acyl carnitine carrier, putative; expressed hypothetical protein TREMEDRAFT_73656 similar to hypothetical protein CNA06520 TREMEDRAFT_29984 similar to hypothetical protein CNBA6390 TREMEDRAFT_30304 similar to hypothetical protein CNBA6400 TREMEDRAFT_30137 similar to hypothetical protein CNBA5970 TREMEDRAFT_15985 similar to hypothetical protein CNBA5980 TREMEDRAFT_13269 similar to hypothetical protein CC1G_01856 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_18980 similar to hypothetical protein CNBA6000 TREMEDRAFT_61683 similar to hypothetical protein CNBA6380 TREMEDRAFT_30002 similar to hypothetical protein CNBA6370 TREMEDRAFT_29606 similar to hypothetical protein CNA06010 TREMEDRAFT_68366 similar to hypothetical protein TREMEDRAFT_61689 predicted protein TREMEDRAFT_73657 similar to carboxymethylenebutenolidase, putative; expressed hypothetical protein TREMEDRAFT_71451 similar to hypothetical protein CNBA6240 TREMEDRAFT_20077 similar to hypothetical protein CNBD3170 TREMEDRAFT_29866 similar to hypothetical protein CNBA6040 TREMEDRAFT_61695 predicted protein TREMEDRAFT_61696 similar to hypothetical protein TREMEDRAFT_73662 similar to PRCDNA35, putative; expressed hypothetical protein TREMEDRAFT_61700 predicted protein TREMEDRAFT_68376 similar to hypothetical protein CNBA6210 TREMEDRAFT_73663 similar to hypothetical protein CNBA6200 TREMEDRAFT_29558 similar to hypothetical protein CNBA6190 TREMEDRAFT_68381 similar to vacuolar protein sorting-associated protein 28 TREMEDRAFT_38611 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_29592 similar to hypothetical protein CNBA6060 TREMEDRAFT_43580 similar to hypothetical protein CC1G_09822 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_61710 similar to hypothetical protein CNA05960 TREMEDRAFT_38616 similar to acetylornithine transaminase, putative; expressed hypothetical protein TREMEDRAFT_71463 similar to hypothetical protein CNBA5960 TREMEDRAFT_61715 predicted protein TREMEDRAFT_68391 similar to hypothetical protein CNBK0560 TREMEDRAFT_61717 similar to hypothetical protein FG03011.1 TREMEDRAFT_61718 predicted protein TREMEDRAFT_73673 expressed protein TREMEDRAFT_61720 predicted protein TREMEDRAFT_56757 similar to nucleoporin nsp1, putative; expressed hypothetical protein TREMEDRAFT_68394 similar to hypothetical protein CNBA7320 TREMEDRAFT_56758 similar to macrofage activating glycoprotein; expressed hypothetical protein TREMEDRAFT_71468 similar to hypothetical protein CNA07560 TREMEDRAFT_61727 predicted protein TREMEDRAFT_17734 similar to hypothetical protein CNA07610 TREMEDRAFT_71470 similar to hypothetical protein UM02071.1; expressed hypothetical protein TREMEDRAFT_38635 similar to hypothetical protein CNBA7530 TREMEDRAFT_61731 predicted protein TREMEDRAFT_61732 predicted protein TREMEDRAFT_61733 predicted protein TREMEDRAFT_30196 similar to predicted protein TREMEDRAFT_61736 similar to hypothetical protein CNA07460 TREMEDRAFT_61737 similar to MetR TREMEDRAFT_71474 similar to hypothetical protein CNBA7470 TREMEDRAFT_30126 similar to hypothetical protein CNBA7300 TREMEDRAFT_38645 similar to d-3-phosphoglycerate dehydrogenase 2, putative; expressed hypothetical protein TREMEDRAFT_61740 similar to hypothetical protein CNBA7330 TREMEDRAFT_61742 predicted protein TREMEDRAFT_61743 similar to hypothetical protein CNBA7420 TREMEDRAFT_68409 similar to hypothetical protein CNBA7410 TREMEDRAFT_29545 similar to hypothetical protein CNBA7540 TREMEDRAFT_61745 similar to hypothetical protein CNBA7550 TREMEDRAFT_17264 similar to hypothetical protein CNBA7560 TREMEDRAFT_30051 similar to hypothetical protein CNBB1660 TREMEDRAFT_61749 predicted protein TREMEDRAFT_30034 similar to nitrilase-like protein, putative TREMEDRAFT_71480 similar to peptidase, putative; expressed hypothetical protein TREMEDRAFT_24087 similar to hypothetical protein PICST_61362 TREMEDRAFT_61758 similar to hypothetical protein CNBB1240 TREMEDRAFT_61760 similar to hypothetical protein TREMEDRAFT_61761 predicted protein TREMEDRAFT_30275 similar to conserved hypothetical protein TREMEDRAFT_61762 predicted protein TREMEDRAFT_61764 predicted protein TREMEDRAFT_61766 predicted protein TREMEDRAFT_61767 similar to cell growth and/or maintenance-related protein, putative TREMEDRAFT_18182 similar to hypothetical protein CNB04420 TREMEDRAFT_43632 similar to 4-nitrophenylphosphatase, putative; expressed hypothetical protein TREMEDRAFT_61772 predicted protein TREMEDRAFT_61773 predicted protein TREMEDRAFT_61774 predicted protein TREMEDRAFT_61775 predicted protein TREMEDRAFT_68429 similar to hypothetical protein CNBB1220 TREMEDRAFT_61777 similar to capping protein (actin filament) muscle Z-line, alpha 2 TREMEDRAFT_71488 similar to hypothetical protein CNB04370 TREMEDRAFT_38680 similar to mitochondrial import receptor subunit tom40, putative; expressed hypothetical protein TREMEDRAFT_29485 similar to hypothetical protein CNBB1460 TREMEDRAFT_38681 similar to phosphoinositide phospholipase C, putative; expressed hypothetical protein TREMEDRAFT_71492 similar to hypothetical protein CNBB0800 TREMEDRAFT_30177 similar to potassium channel, putative TREMEDRAFT_30253 similar to hypothetical protein CNBB0780 TREMEDRAFT_61785 similar to carotene cyclase TREMEDRAFT_61786 predicted protein TREMEDRAFT_29628 similar to hypothetical protein TREMEDRAFT_30228 similar to hypothetical protein CNBB1540 TREMEDRAFT_29362 similar to Endothelin-converting enzyme 1, putative TREMEDRAFT_61790 predicted protein TREMEDRAFT_61791 predicted protein TREMEDRAFT_61792 predicted protein TREMEDRAFT_61793 predicted protein TREMEDRAFT_73699 similar to hypothetical protein CNBB1410 TREMEDRAFT_68443 similar to conserved hypothetical protein TREMEDRAFT_61797 predicted protein TREMEDRAFT_61798 predicted protein TREMEDRAFT_61799 predicted protein TREMEDRAFT_68447 similar to hypothetical protein CNB04500 TREMEDRAFT_14806 similar to hypothetical protein CNBB1430 TREMEDRAFT_61807 predicted protein TREMEDRAFT_30282 similar to hypothetical protein CNB04620 TREMEDRAFT_61809 similar to hypothetical protein CNM02140 TREMEDRAFT_61810 predicted protein TREMEDRAFT_61811 predicted protein TREMEDRAFT_61813 similar to hypothetical protein CNB04620 TREMEDRAFT_61814 similar to hemerythrin HHE cation binding domain protein TREMEDRAFT_61816 similar to hypothetical protein CNBB1300 TREMEDRAFT_61817 similar to hypothetical protein AN5401.2 TREMEDRAFT_38717 similar to rRNA processing-related protein, putative; expressed hypothetical protein TREMEDRAFT_61819 predicted protein TREMEDRAFT_61821 similar to hypothetical protein CNBB1500 TREMEDRAFT_29901 similar to hypothetical protein TREMEDRAFT_30323 similar to hypothetical protein CNB04660 TREMEDRAFT_61824 similar to hypothetical protein CNG04390 TREMEDRAFT_43682 similar to hypothetical protein CNBC4160 TREMEDRAFT_56799 expressed protein TREMEDRAFT_43684 similar to hypothetical protein CNBC4170 TREMEDRAFT_43686 similar to hypothetical protein CNBM0710 TREMEDRAFT_30080 similar to hypothetical protein CNM00810 TREMEDRAFT_61831 predicted protein TREMEDRAFT_61833 predicted protein TREMEDRAFT_71512 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_61835 similar to hypothetical protein CNM00730 TREMEDRAFT_73719 similar to tryptophan 2,3-dioxygenase, putative TREMEDRAFT_30073 similar to predicted protein TREMEDRAFT_61838 similar to hypothetical protein CNBM0680 TREMEDRAFT_29918 similar to hypothetical protein TREMEDRAFT_56803 expressed protein TREMEDRAFT_38743 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_29470 similar to hypothetical protein CNBC4140 TREMEDRAFT_29841 similar to hypothetical protein CNBC4110 TREMEDRAFT_61846 similar to predicted protein TREMEDRAFT_29554 similar to hypothetical protein CNC03060 TREMEDRAFT_71520 similar to transmembrane protein, putative TREMEDRAFT_30284 similar to hypothetical protein CNBC4400 TREMEDRAFT_29882 similar to predicted protein TREMEDRAFT_30267 similar to hypothetical protein CNBC4380 TREMEDRAFT_61859 predicted protein TREMEDRAFT_68480 similar to conserved hypothetical protein TREMEDRAFT_43733 similar to transcriptional activator, putative TREMEDRAFT_68484 similar to hypothetical protein CNBC4050 TREMEDRAFT_61865 similar to hypothetical protein CNBC4360 TREMEDRAFT_73733 expressed protein TREMEDRAFT_16695 similar to hypothetical protein CNA06910 TREMEDRAFT_61869 similar to hypothetical protein CNBA6730 TREMEDRAFT_61870 predicted protein TREMEDRAFT_61871 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_61872 similar to hypothetical protein CNBA5860 TREMEDRAFT_68489 similar to conserved hypothetical protein TREMEDRAFT_30334 similar to hypothetical protein An12g05080 TREMEDRAFT_68491 similar to hypothetical protein TREMEDRAFT_30245 similar to hypothetical protein CNBN0580 TREMEDRAFT_68492 similar to hypothetical protein CNN00570 TREMEDRAFT_29782 similar to hypothetical protein CNBA6480 TREMEDRAFT_30026 similar to ER to Golgi transport-related protein, putative TREMEDRAFT_68494 similar to hypothetical protein CNBA6660 TREMEDRAFT_29634 similar to pathway-specific nitrogen regulator, putative TREMEDRAFT_29967 similar to hypothetical protein CNBA7870 TREMEDRAFT_16119 similar to transporter, putative TREMEDRAFT_68499 similar to hypothetical protein CNBA6790 TREMEDRAFT_56818 expressed protein TREMEDRAFT_73735 similar to hypothetical protein CNBA6780 TREMEDRAFT_71529 similar to Transcription elongation factor SPT5 (Chromatin elongation factor SPT5) TREMEDRAFT_68502 similar to hypothetical protein CNA06740 TREMEDRAFT_23999 similar to 50S ribosomal protein L27 TREMEDRAFT_61888 similar to hypothetical protein CNBA6740 TREMEDRAFT_30205 similar to predicted protein TREMEDRAFT_68505 similar to protein serine/threonine kinase, putative TREMEDRAFT_61891 similar to kinesin, putative TREMEDRAFT_61894 predicted protein TREMEDRAFT_61897 predicted protein TREMEDRAFT_61899 predicted protein TREMEDRAFT_30259 similar to retrotransposon nucleocapsid protein, putative TREMEDRAFT_68510 similar to hypothetical protein CNBA7710 TREMEDRAFT_61903 similar to hypothetical protein CC1G_02037 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_30324 similar to aminotransferase class-III; expressed hypothetical protein TREMEDRAFT_56824 expressed protein TREMEDRAFT_73743 similar to hypothetical protein UM00374.1; expressed hypothetical protein TREMEDRAFT_61908 similar to beta-1,3 exoglucanase precursor-like protein TREMEDRAFT_61911 predicted protein TREMEDRAFT_30027 similar to karyogamy-related protein, putative TREMEDRAFT_29466 similar to CHL1 helicase, putative TREMEDRAFT_56829 similar to methionine sulfoxide reductase; expressed hypothetical protein TREMEDRAFT_61915 similar to hypothetical protein CNBB0710 TREMEDRAFT_56833 expressed protein TREMEDRAFT_73750 expressed protein TREMEDRAFT_68525 similar to hypothetical protein CNBB0440 TREMEDRAFT_71542 similar to hypothetical protein CNBB0450 TREMEDRAFT_56837 expressed protein TREMEDRAFT_29550 similar to conserved hypothetical protein TREMEDRAFT_23604 similar to predicted protein TREMEDRAFT_43786 similar to alpha glucosidase, putative TREMEDRAFT_61928 predicted protein TREMEDRAFT_61929 predicted protein TREMEDRAFT_61930 predicted protein TREMEDRAFT_38830 similar to hypothetical protein CNBB0600 TREMEDRAFT_61933 similar to hypothetical protein CNBB1060 TREMEDRAFT_61934 predicted protein TREMEDRAFT_61936 predicted protein TREMEDRAFT_61937 predicted protein TREMEDRAFT_61938 similar to hypothetical protein CIMG_04839 TREMEDRAFT_61940 predicted protein TREMEDRAFT_61941 predicted protein TREMEDRAFT_61943 similar to integral to membrane protein, putative TREMEDRAFT_43795 similar to predicted protein TREMEDRAFT_29689 similar to predicted protein TREMEDRAFT_71549 similar to conserved hypothetical protein TREMEDRAFT_38846 similar to nam9 protein, mitochondrial precursor, putative; expressed hypothetical protein TREMEDRAFT_61950 similar to hypothetical protein CNBB0830 TREMEDRAFT_43808 similar to Gda1p TREMEDRAFT_61952 similar to predicted protein TREMEDRAFT_29917 similar to hypothetical protein CNC04030 TREMEDRAFT_61954 predicted protein TREMEDRAFT_61955 similar to transcriptional activator, putative TREMEDRAFT_30040 similar to hypothetical protein CNB05190 TREMEDRAFT_29939 similar to hypothetical protein DEHA0F13277g TREMEDRAFT_29571 similar to Palmitoyltransferase PFA4 (Protein fatty acyltransferase 4) TREMEDRAFT_30032 similar to hypothetical protein CNBB1280 TREMEDRAFT_61961 similar to hypothetical protein CNBB1360 TREMEDRAFT_68547 similar to chromatin remodeling-related protein, putative TREMEDRAFT_30281 similar to hypothetical protein CNM00740 TREMEDRAFT_30113 similar to hypothetical protein CNM00770 TREMEDRAFT_61964 similar to hypothetical protein TREMEDRAFT_61965 predicted protein TREMEDRAFT_30320 similar to conserved hypothetical protein TREMEDRAFT_61968 predicted protein TREMEDRAFT_61969 predicted protein TREMEDRAFT_30153 similar to predicted protein TREMEDRAFT_61971 predicted protein TREMEDRAFT_61973 predicted protein TREMEDRAFT_61975 similar to predicted protein TREMEDRAFT_61976 predicted protein TREMEDRAFT_61978 predicted protein TREMEDRAFT_61979 predicted protein TREMEDRAFT_61980 predicted protein TREMEDRAFT_29645 similar to hypothetical protein CNBB5020 TREMEDRAFT_29861 similar to hypothetical protein CNBB5040 TREMEDRAFT_68552 similar to hypothetical protein CNB01170 TREMEDRAFT_68555 similar to hypothetical protein CNBB5080 TREMEDRAFT_30257 similar to hypothetical protein CNBB5070 TREMEDRAFT_61987 predicted protein TREMEDRAFT_30003 similar to hypothetical protein CNBB4880 TREMEDRAFT_29499 similar to hypothetical protein CNBB4890 TREMEDRAFT_68559 similar to hypothetical protein CNBB4930 TREMEDRAFT_73769 similar to hypothetical protein TREMEDRAFT_61994 similar to hypothetical protein CNBB4960 TREMEDRAFT_61995 similar to hypothetical protein CNBD3870 TREMEDRAFT_30206 similar to hypothetical protein CNBB5000 TREMEDRAFT_30169 similar to hypothetical protein CNB00730 TREMEDRAFT_62002 predicted protein TREMEDRAFT_73772 similar to hypothetical protein CNBB4940 TREMEDRAFT_62005 predicted protein TREMEDRAFT_68569 similar to hypothetical protein CNBB5210 TREMEDRAFT_62008 similar to megakaryocyte stimulating factor, putative TREMEDRAFT_62009 predicted protein TREMEDRAFT_38872 similar to hypothetical protein CNBB5120 TREMEDRAFT_29850 similar to hypothetical protein CNBB5160 TREMEDRAFT_43835 similar to histone H2b; expressed hypothetical protein TREMEDRAFT_19608 similar to hypothetical protein NEMVEDRAFT_v1g148947 TREMEDRAFT_73779 similar to Protein transport protein SEC24 TREMEDRAFT_62019 predicted protein TREMEDRAFT_62020 similar to hypothetical protein CNB00520 TREMEDRAFT_29569 similar to hypothetical protein HCAG_09155 TREMEDRAFT_29880 similar to gamma DNA-directed DNA polymerase, putative TREMEDRAFT_62025 similar to hypothetical protein CNBB5340 TREMEDRAFT_62027 similar to hypothetical protein BC1G_09638 TREMEDRAFT_62028 predicted protein TREMEDRAFT_56865 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_29844 similar to hypothetical protein SS1G_03653 TREMEDRAFT_62031 similar to WD-repeat protein, putative TREMEDRAFT_62032 predicted protein TREMEDRAFT_30232 similar to hypothetical protein CNBB5310 TREMEDRAFT_62034 predicted protein TREMEDRAFT_29452 similar to mitochondrial protein required for respiration, putative TREMEDRAFT_62037 similar to hypothetical protein CNBJ0060 TREMEDRAFT_62038 predicted protein TREMEDRAFT_62039 similar to conserved hypothetical protein TREMEDRAFT_62040 predicted protein TREMEDRAFT_43853 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_68589 similar to hypothetical protein MGG_04926 TREMEDRAFT_62043 similar to hypothetical protein CIMG_04839 TREMEDRAFT_62045 similar to hypothetical protein CIMG_04839 TREMEDRAFT_62047 predicted protein TREMEDRAFT_62048 predicted protein TREMEDRAFT_62049 predicted protein TREMEDRAFT_71574 similar to hypothetical protein CNBB5320 TREMEDRAFT_68591 similar to hypothetical protein CNBH0060 TREMEDRAFT_62052 similar to conserved hypothetical protein TREMEDRAFT_73788 similar to hypothetical protein CNBB5560 TREMEDRAFT_38906 similar to hypothetical protein FG01221.1; expressed hypothetical protein TREMEDRAFT_73790 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_43865 similar to taurine catabolism dioxygenase; expressed hypothetical protein TREMEDRAFT_62058 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62059 similar to hypothetical protein CaO19_2204 TREMEDRAFT_30136 similar to hypothetical protein CNBJ2320 TREMEDRAFT_68599 similar to uroporphyrinogen decarboxylase, putative TREMEDRAFT_62064 similar to hypothetical protein CNB00070 TREMEDRAFT_62065 predicted protein TREMEDRAFT_62067 similar to predicted protein TREMEDRAFT_71583 similar to polyadenylation factor 64 kDa subunit, putative; expressed hypothetical protein TREMEDRAFT_43880 similar to hypothetical protein CNBJ2300 TREMEDRAFT_62073 predicted protein TREMEDRAFT_62075 predicted protein TREMEDRAFT_62076 predicted protein TREMEDRAFT_62078 predicted protein TREMEDRAFT_30110 similar to hypothetical protein CNBF0290 TREMEDRAFT_62082 similar to hypothetical protein CNJ01170 TREMEDRAFT_56877 predicted protein TREMEDRAFT_62086 similar to predicted protein TREMEDRAFT_62087 predicted protein TREMEDRAFT_62088 predicted protein TREMEDRAFT_62089 predicted protein TREMEDRAFT_62090 predicted protein TREMEDRAFT_30502 similar to hypothetical protein TREMEDRAFT_16842 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_30753 similar to transaldolase, putative TREMEDRAFT_30567 similar to hypothetical protein An16g05390 TREMEDRAFT_62095 predicted protein TREMEDRAFT_62096 predicted protein TREMEDRAFT_30473 similar to predicted protein TREMEDRAFT_62098 predicted protein TREMEDRAFT_62100 predicted protein TREMEDRAFT_62102 predicted protein TREMEDRAFT_62103 predicted protein TREMEDRAFT_62105 predicted protein TREMEDRAFT_62107 similar to hypothetical protein CIMG_04839 TREMEDRAFT_62108 predicted protein TREMEDRAFT_17689 similar to hypothetical protein PICST_43653 TREMEDRAFT_62110 predicted protein TREMEDRAFT_62112 similar to unnamed protein product TREMEDRAFT_73806 similar to cyclohydrolase, putative; expressed hypothetical protein TREMEDRAFT_62114 predicted protein TREMEDRAFT_62116 predicted protein TREMEDRAFT_62117 similar to hypothetical protein CNBM0210 TREMEDRAFT_62121 similar to hypothetical protein UM02640.1 TREMEDRAFT_62122 predicted protein TREMEDRAFT_62123 predicted protein TREMEDRAFT_43897 similar to hypothetical protein CNBM0120 TREMEDRAFT_62126 predicted protein TREMEDRAFT_62127 predicted protein TREMEDRAFT_62128 predicted protein TREMEDRAFT_62129 predicted protein TREMEDRAFT_17898 similar to hypothetical protein ArthMp028 TREMEDRAFT_62130 predicted protein TREMEDRAFT_62131 similar to delta 9-fatty acid desaturase protein TREMEDRAFT_62132 predicted protein TREMEDRAFT_62133 predicted protein TREMEDRAFT_62134 similar to hypothetical protein CHGG_00078 TREMEDRAFT_62136 predicted protein TREMEDRAFT_62138 predicted protein TREMEDRAFT_62139 predicted protein TREMEDRAFT_62143 predicted protein TREMEDRAFT_30738 similar to folic acid and derivative biosynthesis-related protein, putative TREMEDRAFT_73809 similar to hypothetical protein CNBM1630 TREMEDRAFT_62149 predicted protein TREMEDRAFT_62150 predicted protein TREMEDRAFT_62151 similar to hypothetical protein CNBF1830 TREMEDRAFT_62152 predicted protein TREMEDRAFT_15010 similar to hypothetical protein CNBF1830 TREMEDRAFT_62155 predicted protein TREMEDRAFT_68620 similar to asparaginase, putative TREMEDRAFT_62157 predicted protein TREMEDRAFT_62158 similar to hypothetical protein TREMEDRAFT_30444 similar to hypothetical protein CNBD0790 TREMEDRAFT_30582 similar to hypothetical protein CNBM1680 TREMEDRAFT_62160 predicted protein TREMEDRAFT_30971 similar to hypothetical protein CNBM1700 TREMEDRAFT_30695 similar to hypothetical protein CNBM0820 TREMEDRAFT_68625 similar to hypothetical protein CNBM1590 TREMEDRAFT_62164 predicted protein TREMEDRAFT_62165 predicted protein TREMEDRAFT_62167 similar to hypothetical protein CIMG_04839 TREMEDRAFT_62169 predicted protein TREMEDRAFT_62170 similar to transposase TREMEDRAFT_62171 predicted protein TREMEDRAFT_62173 predicted protein TREMEDRAFT_68629 similar to allantoin permease, putative TREMEDRAFT_62176 predicted protein TREMEDRAFT_62177 predicted protein TREMEDRAFT_30508 similar to hypothetical protein CNM00350 TREMEDRAFT_30806 similar to hypothetical protein CNBM0250 TREMEDRAFT_62182 similar to TPA: TPA_inf: CAP6p TREMEDRAFT_71597 similar to hypothetical protein CNBM0830 TREMEDRAFT_30374 similar to hypothetical protein CNBM0240 TREMEDRAFT_62184 predicted protein TREMEDRAFT_68634 similar to hypothetical protein CNM00220 TREMEDRAFT_62186 predicted protein TREMEDRAFT_43910 similar to hypothetical protein CNM00990 TREMEDRAFT_30908 similar to hypothetical protein CNM00970 TREMEDRAFT_30887 similar to protein ste16, putative; expressed hypothetical protein TREMEDRAFT_30400 similar to hypothetical protein CNM01670 TREMEDRAFT_73821 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_62195 predicted protein TREMEDRAFT_62196 predicted protein TREMEDRAFT_62197 predicted protein TREMEDRAFT_62199 predicted protein TREMEDRAFT_62200 predicted protein TREMEDRAFT_62201 predicted protein TREMEDRAFT_30910 similar to predicted protein TREMEDRAFT_30606 similar to hypothetical protein CNBB4460 TREMEDRAFT_62205 similar to F-actin capping protein beta subunit TREMEDRAFT_62207 predicted protein TREMEDRAFT_62209 predicted protein TREMEDRAFT_62210 predicted protein TREMEDRAFT_62211 predicted protein TREMEDRAFT_17450 similar to hypothetical protein CNBM2280 TREMEDRAFT_30704 similar to hypothetical protein CNBB2010 TREMEDRAFT_43934 similar to oxidoreductase, putative; expressed hypothetical protein TREMEDRAFT_62215 similar to hypothetical protein CNBB2020 TREMEDRAFT_62216 similar to hypothetical protein TREMEDRAFT_68649 similar to hypothetical protein CNBB2040 TREMEDRAFT_30865 similar to hypothetical protein CNBB2100 TREMEDRAFT_62219 predicted protein TREMEDRAFT_30950 similar to hypothetical protein CNBB1860 TREMEDRAFT_68652 similar to hypothetical protein CNBB1870 TREMEDRAFT_62224 similar to DNA repair family protein TREMEDRAFT_62225 similar to hypothetical protein TREMEDRAFT_62226 predicted protein TREMEDRAFT_17281 similar to hypothetical protein CNB03570 TREMEDRAFT_62228 predicted protein TREMEDRAFT_43940 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_62230 similar to hypothetical protein CNB03480 TREMEDRAFT_68655 similar to conserved hypothetical protein TREMEDRAFT_30802 similar to cytoplasm protein, putative TREMEDRAFT_62233 predicted protein TREMEDRAFT_62234 predicted protein TREMEDRAFT_62235 predicted protein TREMEDRAFT_62238 predicted protein TREMEDRAFT_62239 predicted protein TREMEDRAFT_62240 predicted protein TREMEDRAFT_62241 similar to hypothetical protein CNBB2090 TREMEDRAFT_38993 similar to Protein tyrosine kinase, putative; expressed hypothetical protein TREMEDRAFT_30797 similar to hypothetical protein TREMEDRAFT_62246 predicted protein TREMEDRAFT_62247 similar to putative glucosyltransferase TREMEDRAFT_62248 similar to predicted protein TREMEDRAFT_62249 similar to MAP kinase phosphatase, putative TREMEDRAFT_30675 similar to conserved hypothetical protein TREMEDRAFT_68662 predicted protein TREMEDRAFT_68663 similar to hypothetical protein CNBB2390 TREMEDRAFT_62253 predicted protein TREMEDRAFT_62254 predicted protein TREMEDRAFT_62255 similar to hypothetical protein CIMG_03459 TREMEDRAFT_73834 similar to hypothetical protein TREMEDRAFT_62261 similar to bcs1-like protein, putative TREMEDRAFT_73837 similar to hypothetical protein An15g03540 TREMEDRAFT_30617 similar to hypothetical protein CNBK2090 TREMEDRAFT_62268 predicted protein TREMEDRAFT_68672 similar to hypothetical protein CNF04620 TREMEDRAFT_62270 predicted protein TREMEDRAFT_73840 similar to DNA binding protein Ncp1, putative; expressed hypothetical protein TREMEDRAFT_62272 similar to hypothetical protein FG03028.1 TREMEDRAFT_73843 similar to hypothetical protein CNBB2360 TREMEDRAFT_73844 similar to hypothetical protein CNBB2330 TREMEDRAFT_62277 similar to hypothetical protein CNBB2460 TREMEDRAFT_62279 similar to hypothetical protein CNB03400 TREMEDRAFT_68676 similar to hypothetical protein CNBB2280 TREMEDRAFT_62281 predicted protein TREMEDRAFT_62282 predicted protein TREMEDRAFT_62283 predicted protein TREMEDRAFT_73846 predicted protein TREMEDRAFT_30357 similar to hypothetical protein TREMEDRAFT_39017 similar to hypothetical protein CNBB2340 TREMEDRAFT_62288 similar to hypothetical protein CNB03370 TREMEDRAFT_62291 predicted protein TREMEDRAFT_62292 similar to predicted protein TREMEDRAFT_73851 predicted protein TREMEDRAFT_62294 similar to hypothetical protein CNBB2490 TREMEDRAFT_62296 predicted protein TREMEDRAFT_62301 predicted protein TREMEDRAFT_56918 expressed protein TREMEDRAFT_30833 similar to hypothetical protein CNBB2300 TREMEDRAFT_39033 similar to hexokinase, putative; expressed hypothetical protein TREMEDRAFT_62305 similar to hypothetical protein CC1G_10710 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_73857 similar to hypothetical protein CNBB3030 TREMEDRAFT_62307 similar to phospholipid metabolism-related protein, putative TREMEDRAFT_62308 similar to hypothetical protein TREMEDRAFT_71627 similar to ribosomal protein L4, putative; expressed hypothetical protein TREMEDRAFT_71629 similar to conserved hypothetical protein TREMEDRAFT_62312 similar to hypothetical protein PSSM4_007 TREMEDRAFT_62314 similar to hypothetical protein AN5091.2 TREMEDRAFT_39047 similar to lysophospholipase; expressed hypothetical protein TREMEDRAFT_56929 expressed protein TREMEDRAFT_71635 similar to Ser/Thr protein kinase, putative TREMEDRAFT_39054 similar to hypothetical protein CNBB2840 TREMEDRAFT_62321 similar to hypothetical protein CNBB2860 TREMEDRAFT_68702 similar to tRNA adenylyltransferase, putative; expressed hypothetical protein TREMEDRAFT_62325 similar to M protein TREMEDRAFT_62326 predicted protein TREMEDRAFT_68703 similar to hypothetical protein CNBB2790 TREMEDRAFT_68704 similar to hypothetical protein CNBB2740 TREMEDRAFT_56937 expressed protein TREMEDRAFT_71640 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_62331 predicted protein TREMEDRAFT_30937 similar to hypothetical protein FG03067.1 TREMEDRAFT_62335 similar to hypothetical protein CNBB2620 TREMEDRAFT_44022 similar to hypothetical protein CNBB2610 TREMEDRAFT_71644 similar to hypothetical protein CNB03000 TREMEDRAFT_30699 similar to predicted protein TREMEDRAFT_30543 similar to hypothetical protein CNBB2730 TREMEDRAFT_62339 similar to hypothetical protein An18g05720 TREMEDRAFT_62341 similar to hypothetical protein CNBB2640 TREMEDRAFT_62342 similar to hypothetical protein CNBB2700 TREMEDRAFT_73875 similar to hypothetical protein CC1G_02934 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_30458 similar to conserved hypothetical protein TREMEDRAFT_62345 predicted protein TREMEDRAFT_30604 similar to hypothetical protein CNB01100 TREMEDRAFT_73876 similar to hypothetical protein CNBB4600 TREMEDRAFT_62348 similar to hypothetical protein CNBB4590 TREMEDRAFT_68717 similar to hypothetical protein CNBB4620 TREMEDRAFT_62350 similar to hypothetical protein CNBB4580 TREMEDRAFT_62352 similar to hypothetical protein CNBB4570 TREMEDRAFT_30526 similar to hypothetical protein CNBB4630 TREMEDRAFT_68721 similar to hypothetical protein CNBB4640 TREMEDRAFT_71647 similar to hypothetical protein UM04233.1; expressed hypothetical protein TREMEDRAFT_73880 similar to hypothetical protein CNBA5510 TREMEDRAFT_62358 similar to hypothetical protein CNBA5510 TREMEDRAFT_62359 similar to 20 kDa protein having G-X-X-X-Q-X-W- motif TREMEDRAFT_62360 predicted protein TREMEDRAFT_39085 similar to hypothetical protein CNBB4370 TREMEDRAFT_62362 similar to hypothetical protein CC1G_09123 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62363 predicted protein TREMEDRAFT_30965 similar to hypothetical protein CNBB4390 TREMEDRAFT_62365 predicted protein TREMEDRAFT_10419 similar to hypothetical protein CNBB4480 TREMEDRAFT_62369 predicted protein TREMEDRAFT_71653 similar to hypothetical protein CNBB4420 TREMEDRAFT_17516 similar to hypothetical protein CNBH0220 TREMEDRAFT_19459 similar to predicted protein TREMEDRAFT_62372 predicted protein TREMEDRAFT_62373 predicted protein TREMEDRAFT_62374 predicted protein TREMEDRAFT_30795 similar to longevity-assurance protein, putative TREMEDRAFT_24129 similar to predicted protein TREMEDRAFT_30552 similar to Endoplasmic reticulum vesicle protein 25 precursor; expressed hypothetical protein TREMEDRAFT_44048 similar to hypothetical protein CNBB4810 TREMEDRAFT_44051 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_62380 predicted protein TREMEDRAFT_62381 similar to hypothetical protein CNB00920 TREMEDRAFT_62382 predicted protein TREMEDRAFT_62383 similar to M protein TREMEDRAFT_68735 similar to hypothetical protein CNBB4780 TREMEDRAFT_68736 similar to hypothetical protein CNBB4770 TREMEDRAFT_30583 similar to dCMP deaminase, putative TREMEDRAFT_30703 similar to hypothetical protein CNBB4730 TREMEDRAFT_62389 predicted protein TREMEDRAFT_62390 predicted protein TREMEDRAFT_62393 predicted protein TREMEDRAFT_62394 predicted protein TREMEDRAFT_62395 predicted protein TREMEDRAFT_39110 similar to pheromone transporter TREMEDRAFT_68742 similar to hypothetical protein CNBB4690 TREMEDRAFT_44060 similar to hypothetical protein CNBB4240 TREMEDRAFT_71662 similar to hypothetical protein CNBB4330 TREMEDRAFT_62401 predicted protein TREMEDRAFT_62403 predicted protein TREMEDRAFT_73894 similar to hypothetical protein CNBB4320 TREMEDRAFT_73895 similar to hypothetical protein CNBB4170 TREMEDRAFT_62406 predicted protein TREMEDRAFT_30707 similar to hypothetical protein CNBB4300 TREMEDRAFT_62408 predicted protein TREMEDRAFT_62409 similar to hypothetical protein CIMG_04839 TREMEDRAFT_62411 predicted protein TREMEDRAFT_62412 predicted protein TREMEDRAFT_62413 predicted protein TREMEDRAFT_73897 similar to hypothetical protein CNBB4160 TREMEDRAFT_62419 similar to hypothetical protein CNBB3940 TREMEDRAFT_62421 similar to hypothetical protein CNBB3960 TREMEDRAFT_62422 similar to hypothetical protein CNBB3950 TREMEDRAFT_68760 similar to hypothetical protein CNBB4260 TREMEDRAFT_62427 similar to hypothetical protein CNBB4130 TREMEDRAFT_30736 similar to hypothetical protein CNBB4140 TREMEDRAFT_62429 similar to hypothetical protein CNBB4150 TREMEDRAFT_30684 similar to hypothetical protein CNBB3770 TREMEDRAFT_62432 predicted protein TREMEDRAFT_30762 similar to Cas41p TREMEDRAFT_71677 similar to hypothetical protein CNBB3840 TREMEDRAFT_30856 similar to hypothetical protein TREMEDRAFT_73908 similar to hypothetical protein CNBB4040 TREMEDRAFT_62439 similar to hypothetical protein CNBB4220 TREMEDRAFT_62440 predicted protein TREMEDRAFT_62441 similar to hypothetical protein CNBB4220 TREMEDRAFT_62442 predicted protein TREMEDRAFT_62443 predicted protein TREMEDRAFT_62444 predicted protein TREMEDRAFT_62445 similar to hypothetical protein CNBB4220 TREMEDRAFT_62446 predicted protein TREMEDRAFT_62447 similar to hypothetical protein CNBB4220 TREMEDRAFT_62448 similar to hypothetical protein MGG_02347 TREMEDRAFT_62449 similar to hypothetical protein MGG_02347 TREMEDRAFT_73910 similar to hypothetical protein CNB01680 TREMEDRAFT_68769 similar to hypothetical protein CNBB4020 TREMEDRAFT_62456 similar to predicted protein TREMEDRAFT_62458 predicted protein TREMEDRAFT_62459 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62460 predicted protein TREMEDRAFT_62461 predicted protein TREMEDRAFT_71684 expressed protein TREMEDRAFT_62463 predicted protein TREMEDRAFT_62471 predicted protein TREMEDRAFT_62472 predicted protein TREMEDRAFT_62474 predicted protein TREMEDRAFT_62475 predicted protein TREMEDRAFT_62477 predicted protein TREMEDRAFT_62478 predicted protein TREMEDRAFT_71685 similar to hypothetical protein CNBB3750 TREMEDRAFT_30535 similar to hypothetical protein CNBB3760 TREMEDRAFT_62481 predicted protein TREMEDRAFT_30451 similar to hypothetical protein LACBIDRAFT_399462 TREMEDRAFT_30655 similar to hypothetical protein CNBB4210 TREMEDRAFT_62486 similar to hypothetical protein CNBB3500 TREMEDRAFT_44103 similar to hypothetical protein CNBB3470 TREMEDRAFT_39163 similar to ornithine decarboxylase, putative; expressed hypothetical protein TREMEDRAFT_68786 similar to hypothetical protein CNB02070 TREMEDRAFT_62492 predicted protein TREMEDRAFT_62493 predicted protein TREMEDRAFT_62494 similar to hypothetical protein CNBB3660 TREMEDRAFT_68788 similar to hypothetical protein CNBB3670 TREMEDRAFT_62497 predicted protein TREMEDRAFT_62498 predicted protein TREMEDRAFT_62499 similar to histone H3 TREMEDRAFT_62500 similar to hypothetical protein CNBB3710 TREMEDRAFT_68791 similar to hypothetical protein CNBB3480 TREMEDRAFT_30413 similar to hypothetical protein CNBB3490 TREMEDRAFT_44120 similar to hypothetical protein CNBB3730 TREMEDRAFT_73926 similar to unnamed protein product TREMEDRAFT_73927 similar to Os02g0467200; expressed hypothetical protein TREMEDRAFT_30963 similar to hypothetical protein CNBC3170 TREMEDRAFT_30662 similar to conserved hypothetical protein TREMEDRAFT_18262 similar to unnamed protein product TREMEDRAFT_68797 similar to hypothetical protein CNBB3630 TREMEDRAFT_44124 similar to hypothetical protein CNBB3640 TREMEDRAFT_30393 similar to hypothetical protein CNBB3310 TREMEDRAFT_30927 similar to predicted protein TREMEDRAFT_30731 similar to hypothetical protein CC1G_09329 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62521 predicted protein TREMEDRAFT_62522 similar to hypothetical protein CNBB3240 TREMEDRAFT_62523 similar to microtubule motor, putative TREMEDRAFT_30918 similar to hypothetical protein CNBB3600 TREMEDRAFT_62525 predicted protein TREMEDRAFT_73934 similar to hypothetical protein CNBB3270 TREMEDRAFT_19339 similar to ATCOAD (4-PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE) TREMEDRAFT_62530 similar to hypothetical protein TREMEDRAFT_62531 similar to predicted protein TREMEDRAFT_71704 similar to mitochondrial intermediate peptidase mitochondrial precursor; expressed hypothetical protein TREMEDRAFT_62533 predicted protein TREMEDRAFT_30506 similar to hypothetical protein CNBB3400 TREMEDRAFT_62535 predicted protein TREMEDRAFT_62537 similar to hypothetical protein CNBL2520 TREMEDRAFT_62538 similar to hypothetical protein PMN2A_1402 TREMEDRAFT_62539 similar to hypothetical protein CNB02530 TREMEDRAFT_30370 similar to predicted protein TREMEDRAFT_62541 predicted protein TREMEDRAFT_30780 similar to hypothetical protein CNBB3100 TREMEDRAFT_62544 similar to hypothetical protein CNBB3410 TREMEDRAFT_44157 similar to hypothetical protein CNBB3190 TREMEDRAFT_30597 similar to hypothetical protein CNBB2420 TREMEDRAFT_71708 similar to hypothetical protein CNBB2520 TREMEDRAFT_30930 similar to hypothetical protein CNB03160 TREMEDRAFT_30407 similar to hypothetical protein CNBB2540 TREMEDRAFT_62551 predicted protein TREMEDRAFT_62552 predicted protein TREMEDRAFT_30562 similar to hypothetical protein CNBB3070 TREMEDRAFT_30739 similar to hypothetical protein CNBB3060 TREMEDRAFT_62556 predicted protein TREMEDRAFT_62557 similar to hypothetical protein CNBG1450 TREMEDRAFT_62558 predicted protein TREMEDRAFT_73946 similar to hypothetical protein CNBB3130 TREMEDRAFT_62560 predicted protein TREMEDRAFT_62564 predicted protein TREMEDRAFT_62565 similar to hypothetical protein CIMG_04839 TREMEDRAFT_73950 predicted protein TREMEDRAFT_68824 predicted protein TREMEDRAFT_73951 similar to hypothetical protein BpseN_27136 TREMEDRAFT_62569 predicted protein TREMEDRAFT_62572 similar to hypothetical protein CNBB3410 TREMEDRAFT_62573 similar to hypothetical protein CNBB3410 TREMEDRAFT_30677 similar to hypothetical protein CNBB3410 TREMEDRAFT_20830 similar to hypothetical protein CNB03110 TREMEDRAFT_62576 predicted protein TREMEDRAFT_62578 predicted protein TREMEDRAFT_62579 predicted protein TREMEDRAFT_62580 predicted protein TREMEDRAFT_62582 predicted protein TREMEDRAFT_62583 predicted protein TREMEDRAFT_62584 similar to unnamed protein product TREMEDRAFT_62585 predicted protein TREMEDRAFT_31527 similar to hypothetical protein CNBA5250 TREMEDRAFT_31031 similar to inositol phosphorylsphingolipid-phospholipase C TREMEDRAFT_71716 similar to mRNA cap guanine-N7 methyltransferase (mRNA (guanine-N(7)-)-methyltransferase) (mRNA cap methyltransferase) TREMEDRAFT_31214 similar to Polyadenylation factor subunit 2 TREMEDRAFT_31192 similar to hypothetical protein CNBC5840 TREMEDRAFT_31161 similar to hypothetical protein CNBC5860 TREMEDRAFT_31549 similar to transcription coactivator, putative TREMEDRAFT_68833 similar to hypothetical protein CNM01730 TREMEDRAFT_68834 similar to hypothetical protein CNBA5390 TREMEDRAFT_44181 similar to cAMP-dependent protein kinase regulatory subunit; expressed hypothetical protein TREMEDRAFT_62596 similar to cysteine synthase, putative TREMEDRAFT_31481 similar to cytoplasm protein, putative TREMEDRAFT_31188 similar to hypothetical protein CNBA5230 TREMEDRAFT_13987 similar to small nuclear ribonucleoprotein hPrp3, putative TREMEDRAFT_31049 similar to hypothetical protein CNBA5340 TREMEDRAFT_62601 predicted protein TREMEDRAFT_62603 predicted protein TREMEDRAFT_31047 similar to hypothetical protein CNBL2540 TREMEDRAFT_31209 similar to hypothetical protein CNBL2550 TREMEDRAFT_31295 similar to hypothetical protein CNBA5310 TREMEDRAFT_31124 similar to hypothetical protein CNBA5320 TREMEDRAFT_31245 similar to hypothetical protein CNBA5330 TREMEDRAFT_68850 similar to predicted protein TREMEDRAFT_31125 similar to hypothetical protein CNBC5590 TREMEDRAFT_31441 similar to hypothetical protein CNBC5800 TREMEDRAFT_68852 similar to hypothetical protein CNBC5810 TREMEDRAFT_62613 similar to hypothetical protein CNH02360 TREMEDRAFT_68853 similar to 5' TREMEDRAFT_62617 predicted protein TREMEDRAFT_62618 similar to arabinogalactan protein TREMEDRAFT_62620 predicted protein TREMEDRAFT_22436 similar to conserved hypothetical protein TREMEDRAFT_62622 predicted protein TREMEDRAFT_62623 predicted protein TREMEDRAFT_31511 similar to hypothetical protein CNC07080 TREMEDRAFT_68856 similar to hypothetical protein CNBC0100 TREMEDRAFT_62626 predicted protein TREMEDRAFT_62628 similar to hypothetical protein CNBC0010 TREMEDRAFT_62629 predicted protein TREMEDRAFT_62630 predicted protein TREMEDRAFT_62631 predicted protein TREMEDRAFT_62632 predicted protein TREMEDRAFT_62633 similar to predicted protein TREMEDRAFT_68860 similar to hypothetical protein CNBH1060 TREMEDRAFT_68862 similar to hypothetical protein CNBK2980 TREMEDRAFT_62637 predicted protein TREMEDRAFT_62638 similar to hypothetical protein CNBK2970 TREMEDRAFT_31144 similar to hypothetical protein CNK02980 TREMEDRAFT_68864 similar to hypothetical protein CNBI1420 TREMEDRAFT_31066 similar to alpha-1,6-mannosyltransferase, putative TREMEDRAFT_31055 similar to hypothetical protein CC1G_01923 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31519 similar to hypothetical protein CNBC3470 TREMEDRAFT_62643 similar to oxidoreductase, putative TREMEDRAFT_62644 similar to unnamed protein product TREMEDRAFT_68867 similar to hypothetical protein CNA06960 TREMEDRAFT_68868 similar to hypothetical protein CNBC6290 TREMEDRAFT_68869 similar to unnamed protein product TREMEDRAFT_31271 similar to unnamed protein product TREMEDRAFT_30985 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_68871 similar to MFS sugar transporter, putative TREMEDRAFT_62650 similar to unnamed protein product TREMEDRAFT_62651 similar to trehalose transport-related protein, putative TREMEDRAFT_73967 similar to cell wall chitin catabolism-related protein, putative TREMEDRAFT_62653 predicted protein TREMEDRAFT_31269 similar to hypothetical protein CNBH1050 TREMEDRAFT_62655 similar to hypothetical protein CNBD1530 TREMEDRAFT_62656 similar to hypothetical protein CNBD1540 TREMEDRAFT_31504 similar to hypothetical protein CC1G_07382 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31388 similar to hypothetical protein CNI01150 TREMEDRAFT_62660 predicted protein TREMEDRAFT_62661 similar to hypothetical protein CNBH1090 TREMEDRAFT_62662 similar to hypothetical protein CNBG1950 TREMEDRAFT_68880 similar to hypothetical protein CNBD1550 TREMEDRAFT_62665 predicted protein TREMEDRAFT_73971 similar to hypothetical protein CNBG0390 TREMEDRAFT_68884 similar to hypothetical protein CNBC6260 TREMEDRAFT_73973 similar to hypothetical protein CNBD1570 TREMEDRAFT_62670 predicted protein TREMEDRAFT_62671 predicted protein TREMEDRAFT_62673 similar to hypothetical protein CNBL0550 TREMEDRAFT_39283 similar to sphinganine-1-phosphate aldolase, putative; expressed hypothetical protein TREMEDRAFT_15463 similar to conserved hypothetical protein TREMEDRAFT_31343 similar to hypothetical protein CNBL0100 TREMEDRAFT_44230 similar to processing of 20S pre-rRNA-related protein, putative; expressed hypothetical protein TREMEDRAFT_62681 similar to hypothetical protein BBOV_I000380 TREMEDRAFT_73979 similar to hypothetical protein CNH00150 TREMEDRAFT_73980 similar to nucleolus protein, putative TREMEDRAFT_71742 similar to glutamate 5-kinase, putative TREMEDRAFT_39301 similar to hypothetical protein CNBC0540 TREMEDRAFT_73985 similar to suppressor protein SPT23, putative TREMEDRAFT_62690 similar to hypothetical protein MGL_4148 TREMEDRAFT_73986 similar to hypothetical protein CNBC0670 TREMEDRAFT_62693 predicted protein TREMEDRAFT_62695 similar to hypothetical protein CIMG_04839 TREMEDRAFT_62696 similar to hypothetical protein CHGG_00078 TREMEDRAFT_62697 similar to hypothetical protein CNC06570 TREMEDRAFT_62698 predicted protein TREMEDRAFT_71746 expressed protein TREMEDRAFT_62699 predicted protein TREMEDRAFT_68898 similar to hypothetical protein CNBC0730 TREMEDRAFT_62701 predicted protein TREMEDRAFT_44243 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_62705 predicted protein TREMEDRAFT_62706 predicted protein TREMEDRAFT_62707 predicted protein TREMEDRAFT_62709 predicted protein TREMEDRAFT_62710 predicted protein TREMEDRAFT_73991 expressed protein TREMEDRAFT_68902 similar to hypothetical protein CNBC0600 TREMEDRAFT_62716 similar to hypothetical protein CNBC0590 TREMEDRAFT_62718 similar to hypothetical protein CNBC0710 TREMEDRAFT_62719 predicted protein TREMEDRAFT_73994 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31510 similar to hypothetical protein CNBG4670 TREMEDRAFT_62723 similar to hypothetical protein CNBC0570 TREMEDRAFT_68910 similar to hypothetical protein CNBI0200 TREMEDRAFT_39321 similar to ATP-dependent DNA helicase pcra, putative TREMEDRAFT_62726 similar to hypothetical protein CNBC0750 TREMEDRAFT_73998 similar to unnamed protein product TREMEDRAFT_44257 similar to hypothetical protein CNC07020 TREMEDRAFT_62730 similar to predicted protein TREMEDRAFT_71756 similar to hypothetical protein CNBC0480 TREMEDRAFT_62734 similar to hypothetical protein CNBC0460 TREMEDRAFT_62735 similar to hypothetical protein CNC06740 TREMEDRAFT_31453 similar to predicted protein TREMEDRAFT_62737 similar to hypothetical protein CC1G_05208 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62738 similar to predicted protein TREMEDRAFT_62739 similar to hypothetical protein CNBC0070 TREMEDRAFT_68922 similar to hypothetical protein CNBL2330 TREMEDRAFT_62741 similar to predicted protein TREMEDRAFT_44265 similar to cyclin-dependent protein kinase Cdc2; expressed hypothetical protein TREMEDRAFT_31207 similar to hypothetical protein CNBC5490 TREMEDRAFT_31394 similar to hypothetical protein CNBC5470 TREMEDRAFT_31404 similar to hypothetical protein UM02132.1 TREMEDRAFT_62747 predicted protein TREMEDRAFT_62749 predicted protein TREMEDRAFT_31220 similar to hypothetical protein CNH02330 TREMEDRAFT_71761 similar to hypothetical protein CNBL2580 TREMEDRAFT_31265 similar to hypothetical protein CNBL2590 TREMEDRAFT_62753 predicted protein TREMEDRAFT_62756 predicted protein TREMEDRAFT_62757 predicted protein TREMEDRAFT_62758 predicted protein TREMEDRAFT_62759 predicted protein TREMEDRAFT_62763 predicted protein TREMEDRAFT_62765 predicted protein TREMEDRAFT_62767 predicted protein TREMEDRAFT_62768 predicted protein TREMEDRAFT_62770 similar to hypothetical protein CIMG_04839 TREMEDRAFT_44276 similar to hypothetical protein CNBL2620 TREMEDRAFT_31426 similar to predicted protein TREMEDRAFT_14479 similar to Cell division protein kinase 9 (Cyclin-dependent kinase 9) TREMEDRAFT_62779 similar to hypothetical protein MGL_3509 TREMEDRAFT_62780 similar to hypothetical protein BuboB_01187 TREMEDRAFT_74010 expressed protein TREMEDRAFT_57076 expressed protein TREMEDRAFT_74012 similar to conserved hypothetical protein TREMEDRAFT_62784 similar to hypothetical protein CNBC5550 TREMEDRAFT_68940 similar to hypothetical protein CNBC5540 TREMEDRAFT_16009 similar to hypothetical protein CNBC5530 TREMEDRAFT_44282 similar to hypothetical protein CNBC5510 TREMEDRAFT_62788 similar to hypothetical protein CC1G_10813 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62789 similar to RAS protein, putative TREMEDRAFT_15322 similar to hypothetical protein CNBA5200 TREMEDRAFT_68945 similar to hypothetical protein CNBL1700 TREMEDRAFT_62793 similar to hypothetical protein CNBL1710 TREMEDRAFT_62794 predicted protein TREMEDRAFT_31191 similar to conserved hypothetical protein TREMEDRAFT_31506 similar to alpha/beta fold family hydrolase, putative TREMEDRAFT_31446 similar to hypothetical protein CNBL1930 TREMEDRAFT_74017 predicted protein TREMEDRAFT_31568 similar to hypothetical protein CNBC5450 TREMEDRAFT_62803 similar to conserved hypothetical protein TREMEDRAFT_62806 similar to carboxyl transferase TREMEDRAFT_57085 expressed protein TREMEDRAFT_44294 similar to catalase 3; expressed hypothetical protein TREMEDRAFT_62809 similar to hypothetical protein TREMEDRAFT_74024 predicted protein TREMEDRAFT_31348 similar to hypothetical protein CNBK2010 TREMEDRAFT_12302 similar to hypothetical protein CNBA5440 TREMEDRAFT_31184 similar to hypothetical protein CNBL1710 TREMEDRAFT_62819 predicted protein TREMEDRAFT_62820 predicted protein TREMEDRAFT_62821 similar to predicted protein TREMEDRAFT_57092 expressed protein TREMEDRAFT_62822 similar to hypothetical protein CNBL2520 TREMEDRAFT_31233 similar to hypothetical protein CNBL2420 TREMEDRAFT_11471 similar to hypothetical protein CNBL2880 TREMEDRAFT_62826 similar to proteophosphoglycan ppg3, putative [Leishmania braziliensis MHOM/BR/75/M2904] TREMEDRAFT_62827 predicted protein TREMEDRAFT_31415 similar to specific transcriptional repressor, putative TREMEDRAFT_31421 similar to hypothetical protein CNBL2660 TREMEDRAFT_31189 similar to hypothetical protein CNBL2530 TREMEDRAFT_62830 similar to hypothetical protein AN3352.2 TREMEDRAFT_68967 similar to hypothetical protein CNBL2450 TREMEDRAFT_62833 predicted protein TREMEDRAFT_31469 similar to hypothetical protein CNH01780 TREMEDRAFT_11782 similar to hypothetical protein CNBL1990 TREMEDRAFT_62836 similar to hypothetical protein TREMEDRAFT_62837 predicted protein TREMEDRAFT_44314 similar to hypothetical protein CNBL2850 TREMEDRAFT_31058 similar to hypothetical protein CNBL2860 TREMEDRAFT_68977 similar to hypothetical protein CNBL1820 TREMEDRAFT_62847 similar to hypothetical protein CNBL2700 TREMEDRAFT_74039 similar to hypothetical protein CNH02850 TREMEDRAFT_62849 predicted protein TREMEDRAFT_62850 predicted protein TREMEDRAFT_62851 predicted protein TREMEDRAFT_62852 similar to paternally expressed 10 TREMEDRAFT_62854 predicted protein TREMEDRAFT_62855 similar to hypothetical protein CNBL1810 TREMEDRAFT_62856 predicted protein TREMEDRAFT_68982 similar to hypothetical protein CNH01810 TREMEDRAFT_74041 predicted protein TREMEDRAFT_71793 similar to hypothetical protein CNBL2050 TREMEDRAFT_44321 similar to cytochrome b5, putative; expressed hypothetical protein TREMEDRAFT_20267 similar to hypothetical protein MGL_3590 TREMEDRAFT_31230 similar to hypothetical protein CNH02020 TREMEDRAFT_62864 predicted protein TREMEDRAFT_62865 predicted protein TREMEDRAFT_62868 predicted protein TREMEDRAFT_62870 predicted protein TREMEDRAFT_31148 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_62872 similar to hypothetical protein TREMEDRAFT_31565 similar to peroxisome assembly protein per8 (peroxin-10), putative TREMEDRAFT_68989 similar to hypothetical protein CNBL2100 TREMEDRAFT_13370 similar to hypothetical protein CNH02100 TREMEDRAFT_62876 similar to hypothetical protein CNBL2080 TREMEDRAFT_62877 similar to hypothetical protein CNBL2130 TREMEDRAFT_68992 similar to hypothetical protein CNBL2140 TREMEDRAFT_68993 similar to hypothetical protein CNBL2150 TREMEDRAFT_71796 similar to hypothetical protein CNH02180 TREMEDRAFT_31333 similar to hypothetical protein CNH02190 TREMEDRAFT_31036 similar to hypothetical protein CNH02200 TREMEDRAFT_16788 similar to hypothetical protein CNBL2210 TREMEDRAFT_62883 predicted protein TREMEDRAFT_62884 predicted protein TREMEDRAFT_62885 predicted protein TREMEDRAFT_62886 predicted protein TREMEDRAFT_62887 predicted protein TREMEDRAFT_62888 predicted protein TREMEDRAFT_31545 similar to hypothetical protein CNBL2250 TREMEDRAFT_68999 similar to hypothetical protein CNBL2160 TREMEDRAFT_62894 predicted protein TREMEDRAFT_31011 similar to hypothetical protein CNBL1860 TREMEDRAFT_69003 similar to hypothetical protein CNBL1870 TREMEDRAFT_69004 similar to glucosylceramide synthase TREMEDRAFT_31499 similar to hypothetical protein CNBL1680 TREMEDRAFT_39416 similar to hypothetical protein CNBL1890 TREMEDRAFT_31392 similar to hypothetical protein CNBL1880 TREMEDRAFT_57116 expressed protein TREMEDRAFT_62902 predicted protein TREMEDRAFT_44343 similar to hypothetical protein CNBL1620 TREMEDRAFT_71806 similar to ATPase, putative TREMEDRAFT_62905 similar to hypothetical protein An01g03210 TREMEDRAFT_17451 similar to hypothetical protein CNBM2280 TREMEDRAFT_62911 predicted protein TREMEDRAFT_69016 similar to hypothetical protein CC1G_11052 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31472 similar to hypothetical protein TREMEDRAFT_57120 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_44358 similar to hypothetical protein TREMEDRAFT_31436 similar to hypothetical protein CNBL1550 TREMEDRAFT_31374 similar to hypothetical protein CNBL1540 TREMEDRAFT_62922 similar to hypothetical protein CNBL1530 TREMEDRAFT_31051 similar to hypothetical protein CNBL1510 TREMEDRAFT_62924 similar to hypothetical protein CNBL1500 TREMEDRAFT_44369 similar to ABC protein TREMEDRAFT_39451 similar to chitin synthase 4 TREMEDRAFT_62931 predicted protein TREMEDRAFT_62932 similar to hypothetical protein TREMEDRAFT_31528 similar to hypothetical protein CNBL1400 TREMEDRAFT_69030 similar to hypothetical protein CNH01430 TREMEDRAFT_31309 similar to Ser/Thr protein kinase, putative TREMEDRAFT_31162 similar to hypothetical protein CNBL1370 TREMEDRAFT_62937 predicted protein TREMEDRAFT_44374 similar to hypothetical protein CNBL1320 TREMEDRAFT_62939 similar to hypothetical protein CNBL1330 TREMEDRAFT_31258 similar to hypothetical protein CNBL1340 TREMEDRAFT_62941 predicted protein TREMEDRAFT_62942 predicted protein TREMEDRAFT_62943 predicted protein TREMEDRAFT_62945 predicted protein TREMEDRAFT_62946 predicted protein TREMEDRAFT_62947 predicted protein TREMEDRAFT_62948 predicted protein TREMEDRAFT_62951 predicted protein TREMEDRAFT_62952 predicted protein TREMEDRAFT_62954 similar to hypothetical protein CNB00460 TREMEDRAFT_57128 expressed protein TREMEDRAFT_62957 predicted protein TREMEDRAFT_62958 predicted protein TREMEDRAFT_31078 similar to hypothetical protein CNBL1250 TREMEDRAFT_62961 similar to unnamed protein product TREMEDRAFT_62962 predicted protein TREMEDRAFT_74070 similar to hypothetical protein, partial TREMEDRAFT_62965 predicted protein TREMEDRAFT_62967 predicted protein TREMEDRAFT_62968 predicted protein TREMEDRAFT_39463 similar to multidrug resistance protein 1 TREMEDRAFT_22027 similar to hypothetical protein CHGG_03492 TREMEDRAFT_62973 similar to histidine acid phosphatase, putative TREMEDRAFT_32024 similar to predicted protein TREMEDRAFT_32017 similar to hypothetical protein CNBD3920 TREMEDRAFT_62976 predicted protein TREMEDRAFT_74074 similar to hypothetical protein CNBF0520 TREMEDRAFT_21899 similar to guanine deaminase, isoform CRA_b TREMEDRAFT_32061 similar to oxidoreductase, putative TREMEDRAFT_74075 predicted protein TREMEDRAFT_62983 predicted protein TREMEDRAFT_13294 similar to hypothetical protein CNBF0550 TREMEDRAFT_62986 predicted protein TREMEDRAFT_62987 predicted protein TREMEDRAFT_62990 predicted protein TREMEDRAFT_62992 similar to Hypothetical protein K08D12.3a TREMEDRAFT_62994 predicted protein TREMEDRAFT_62995 similar to hypothetical protein CNBF0640 TREMEDRAFT_39479 similar to hypothetical protein CNBF0080 TREMEDRAFT_32029 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_31801 similar to hypothetical protein CNBF0410 TREMEDRAFT_44404 similar to hydroxymethylglutaryl-CoA reductase (NADPH), putative TREMEDRAFT_69058 similar to hypothetical protein CNBF0150 TREMEDRAFT_63006 predicted protein TREMEDRAFT_31917 similar to ATP-dependent permease, putative TREMEDRAFT_63008 predicted protein TREMEDRAFT_71834 similar to hypothetical protein CNBF0580 TREMEDRAFT_63011 predicted protein TREMEDRAFT_63012 predicted protein TREMEDRAFT_63013 predicted protein TREMEDRAFT_63014 predicted protein TREMEDRAFT_63015 predicted protein TREMEDRAFT_63016 predicted protein TREMEDRAFT_63017 predicted protein TREMEDRAFT_71836 similar to hypothetical protein CNBF0330 TREMEDRAFT_63019 similar to hypothetical protein CNBF0320 TREMEDRAFT_31892 similar to hypothetical protein CNBF0730 TREMEDRAFT_74089 similar to clathrin-coated vesicle protein, putative TREMEDRAFT_63023 similar to hypothetical protein CIMG_09560 TREMEDRAFT_63024 similar to hypothetical protein CNBF0700 TREMEDRAFT_63029 predicted protein TREMEDRAFT_63030 predicted protein TREMEDRAFT_13762 similar to hypothetical protein CNBF0680 TREMEDRAFT_63033 predicted protein TREMEDRAFT_63034 predicted protein TREMEDRAFT_63035 predicted protein TREMEDRAFT_63037 predicted protein TREMEDRAFT_31675 similar to hypothetical protein CNBF0250 TREMEDRAFT_63041 similar to hypothetical protein CNBF0260 TREMEDRAFT_63042 predicted protein TREMEDRAFT_63045 similar to hCG1793893 TREMEDRAFT_69081 similar to endoplasmic reticulum protein, putative TREMEDRAFT_74099 similar to hypothetical protein CNBD1140 TREMEDRAFT_57145 expressed protein TREMEDRAFT_57146 expressed protein TREMEDRAFT_63051 similar to Os12g0625200 TREMEDRAFT_19925 similar to hypothetical protein CND04640 TREMEDRAFT_31795 similar to hypothetical protein CNA07170 TREMEDRAFT_31601 similar to hypothetical protein CND04730 TREMEDRAFT_31879 similar to predicted protein TREMEDRAFT_74105 similar to hypothetical protein CNBN1860 TREMEDRAFT_63059 predicted protein TREMEDRAFT_31680 similar to mRNA-capping enzyme subunit beta (Polynucleotide 5'-triphosphatase) (mRNA 5'-triphosphatase) (TPase) TREMEDRAFT_69086 similar to 30S ribosomal protein S12 TREMEDRAFT_63063 predicted protein TREMEDRAFT_69087 similar to hypothetical protein CNBF0240 TREMEDRAFT_74106 similar to hypothetical protein CNBF0230 TREMEDRAFT_31855 similar to Nucleolar GTP-binding protein 2 TREMEDRAFT_31766 similar to predicted protein TREMEDRAFT_31674 similar to hypothetical protein CNBD0850 TREMEDRAFT_44456 similar to hypothetical protein CNBN2240 TREMEDRAFT_63071 similar to general amino acid permease 1 TREMEDRAFT_18302 similar to hypothetical protein CND05650 TREMEDRAFT_63073 predicted protein TREMEDRAFT_57154 expressed protein TREMEDRAFT_63075 predicted protein TREMEDRAFT_57155 similar to HSP12 TREMEDRAFT_31623 similar to hypothetical protein CNM01410 TREMEDRAFT_63079 predicted protein TREMEDRAFT_63080 similar to hypothetical protein CND05620 TREMEDRAFT_63081 similar to hypothetical protein CND05350 TREMEDRAFT_31582 similar to hypothetical protein LACBIDRAFT_306571 TREMEDRAFT_63083 similar to hypothetical protein CNBD0910 TREMEDRAFT_69095 predicted protein TREMEDRAFT_69096 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_69097 similar to hypothetical protein CNBD0830 TREMEDRAFT_44460 similar to hypothetical protein CNBD0840 TREMEDRAFT_71858 similar to hypothetical protein CNBD0820 TREMEDRAFT_57164 similar to hypothetical protein CNBD0960 TREMEDRAFT_63090 predicted protein TREMEDRAFT_23453 similar to hypothetical protein CNBD1260 TREMEDRAFT_69103 similar to hypothetical protein CND05100 TREMEDRAFT_63095 predicted protein TREMEDRAFT_63096 predicted protein TREMEDRAFT_63097 predicted protein TREMEDRAFT_57167 similar to putative acetyltransferase; expressed hypothetical protein TREMEDRAFT_31603 similar to hypothetical protein CNBE1060 TREMEDRAFT_57168 expressed protein TREMEDRAFT_31612 similar to oxidoreductase TREMEDRAFT_23916 similar to predicted protein TREMEDRAFT_31876 similar to hypothetical protein CNBD1330 TREMEDRAFT_63105 predicted protein TREMEDRAFT_31647 similar to hypothetical protein CNBD1360 TREMEDRAFT_71861 expressed protein TREMEDRAFT_63107 predicted protein TREMEDRAFT_57172 predicted protein TREMEDRAFT_57173 expressed protein TREMEDRAFT_57174 expressed protein TREMEDRAFT_63113 predicted protein TREMEDRAFT_18879 similar to hypothetical protein CNBD1060 TREMEDRAFT_63117 predicted protein TREMEDRAFT_39559 similar to heat shock protein HSP60, putative; expressed hypothetical protein TREMEDRAFT_31774 similar to hypothetical protein CNBD1180 TREMEDRAFT_39562 similar to hypothetical protein CNBD1500 TREMEDRAFT_31681 similar to Defective in cullin neddylation protein 1 TREMEDRAFT_63123 similar to hypothetical protein CNBD0930 TREMEDRAFT_31687 similar to hypothetical protein CNBD1320 TREMEDRAFT_74127 predicted protein TREMEDRAFT_31912 similar to hypothetical protein CNBD1410 TREMEDRAFT_69127 similar to hypothetical protein CNBD1420 TREMEDRAFT_20176 similar to hypothetical protein CND04920 TREMEDRAFT_32015 similar to hypothetical protein TREMEDRAFT_31716 similar to hypothetical protein CNBD1030 TREMEDRAFT_39577 similar to hypothetical protein CNBD1020 TREMEDRAFT_63134 predicted protein TREMEDRAFT_22270 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31884 similar to hypothetical protein CNBD1450 TREMEDRAFT_63139 predicted protein TREMEDRAFT_69133 similar to hypothetical protein CNBD1010 TREMEDRAFT_31622 similar to hypothetical protein CNBN2160 TREMEDRAFT_32065 similar to predicted protein TREMEDRAFT_32058 similar to PAN6p TREMEDRAFT_74134 predicted protein TREMEDRAFT_71878 similar to hypothetical protein CNBL0580 TREMEDRAFT_74136 similar to chitin synthase-related TREMEDRAFT_63150 similar to predicted protein TREMEDRAFT_63151 similar to predicted protein TREMEDRAFT_39597 similar to hypothetical protein CC1G_06853 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31906 similar to SP9; expressed hypothetical protein TREMEDRAFT_71885 similar to STE20; expressed hypothetical protein TREMEDRAFT_57194 expressed protein TREMEDRAFT_57195 expressed protein TREMEDRAFT_69149 similar to hypothetical protein CNBD4760 TREMEDRAFT_31780 similar to ZNF1 TREMEDRAFT_71889 similar to PRT1; expressed hypothetical protein TREMEDRAFT_31854 similar to hypothetical protein SS1G_05913 TREMEDRAFT_11927 similar to hypothetical protein UM03643.1 TREMEDRAFT_31883 similar to hypothetical protein CNBL1040 TREMEDRAFT_74147 similar to ribosome biogenesis and assembly-related protein, putative; expressed hypothetical protein TREMEDRAFT_69156 similar to RPO41p TREMEDRAFT_32039 similar to predicted protein TREMEDRAFT_71892 similar to ETF1-related; expressed hypothetical protein TREMEDRAFT_23695 similar to hypothetical protein CNBD4780 TREMEDRAFT_74150 similar to hypothetical protein CNBH0170 TREMEDRAFT_63174 similar to hypothetical protein CC1G_03780 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_12167 similar to hypothetical protein CNBD0690 TREMEDRAFT_69163 similar to Probable kinetochore protein NDC80 TREMEDRAFT_63177 predicted protein TREMEDRAFT_63178 similar to hypothetical protein CNBA3070 TREMEDRAFT_44537 similar to endopeptidase, putative; expressed hypothetical protein TREMEDRAFT_32011 similar to IKS1p TREMEDRAFT_57202 similar to hypothetical protein AN9079.2; expressed hypothetical protein TREMEDRAFT_39631 similar to hypothetical protein CNBD1070 TREMEDRAFT_63184 similar to hypothetical protein AN3986.2 TREMEDRAFT_63186 predicted protein TREMEDRAFT_39635 similar to O-mannosyltransferase; expressed hypothetical protein TREMEDRAFT_63190 predicted protein TREMEDRAFT_31927 similar to hypothetical protein CND01580 TREMEDRAFT_44549 similar to hypothetical protein CND01520 TREMEDRAFT_63193 similar to hypothetical protein CNBD0490 TREMEDRAFT_32037 similar to NADPH oxidase B TREMEDRAFT_31990 similar to hypothetical protein CNBD4860 TREMEDRAFT_31825 similar to hypothetical protein CND01250 TREMEDRAFT_71902 similar to hypothetical protein CNBD4850 TREMEDRAFT_63199 similar to hypothetical protein CNBD4980 TREMEDRAFT_63200 similar to glutathione transferase, putative TREMEDRAFT_74161 similar to hypothetical protein CND01350 TREMEDRAFT_63202 similar to hypothetical protein CNBD5130 TREMEDRAFT_63203 similar to hypothetical protein CND01180 TREMEDRAFT_63204 predicted protein TREMEDRAFT_69180 similar to hypothetical protein CNBD5070 TREMEDRAFT_71903 similar to hypothetical protein CNBD4990 TREMEDRAFT_31874 similar to hypothetical protein CC1G_11558 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_63207 similar to hypothetical protein CNBD5020 TREMEDRAFT_71904 expressed protein TREMEDRAFT_17977 similar to hypothetical protein CNBD5090 TREMEDRAFT_63211 similar to hypothetical protein TREMEDRAFT_63213 similar to RUM1 TREMEDRAFT_39658 similar to GEF1p TREMEDRAFT_39663 similar to CID1; expressed hypothetical protein TREMEDRAFT_63217 predicted protein TREMEDRAFT_71908 expressed protein TREMEDRAFT_63219 predicted protein TREMEDRAFT_63223 predicted protein TREMEDRAFT_22767 similar to hypothetical protein CNBD4870 TREMEDRAFT_63225 similar to hypothetical protein CNBD4880 TREMEDRAFT_74170 similar to hypothetical protein TREMEDRAFT_31804 similar to hypothetical protein CNBD4730 TREMEDRAFT_31933 similar to hypothetical protein CNBD5510 TREMEDRAFT_63229 predicted protein TREMEDRAFT_63230 similar to hypothetical protein CNBD5490 TREMEDRAFT_31815 similar to hypothetical protein CNBD5480 TREMEDRAFT_63232 similar to putative Levodione reductase ((6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase) TREMEDRAFT_44572 similar to hypothetical protein CNBD5140 TREMEDRAFT_63234 predicted protein TREMEDRAFT_63235 similar to predicted protein TREMEDRAFT_74172 expressed protein TREMEDRAFT_16760 similar to unnamed protein product TREMEDRAFT_63238 similar to conserved hypothetical protein TREMEDRAFT_63239 predicted protein TREMEDRAFT_63241 similar to gag TREMEDRAFT_63242 predicted protein TREMEDRAFT_63244 predicted protein TREMEDRAFT_63245 predicted protein TREMEDRAFT_63246 predicted protein TREMEDRAFT_63248 similar to hypothetical protein CIMG_04839 TREMEDRAFT_63249 predicted protein TREMEDRAFT_63250 predicted protein TREMEDRAFT_69198 similar to hypothetical protein BC1G_05208 TREMEDRAFT_63253 predicted protein TREMEDRAFT_63254 predicted protein TREMEDRAFT_63255 similar to ferric-chelate reductase, putative TREMEDRAFT_63258 similar to hypothetical protein CNBB5060 TREMEDRAFT_63259 predicted protein TREMEDRAFT_63260 predicted protein TREMEDRAFT_63261 predicted protein TREMEDRAFT_63262 predicted protein TREMEDRAFT_71915 similar to hypothetical protein CNBD6090 TREMEDRAFT_63266 predicted protein TREMEDRAFT_69204 similar to hypothetical protein CNBD6070 TREMEDRAFT_63268 predicted protein TREMEDRAFT_63269 predicted protein TREMEDRAFT_44583 similar to hypothetical protein CNBD6080 TREMEDRAFT_12143 similar to hypothetical protein CNBD6100 TREMEDRAFT_74177 expressed protein TREMEDRAFT_31800 similar to transport protein particle complex subunit TREMEDRAFT_69207 similar to hypothetical protein CNBD0250 TREMEDRAFT_63274 similar to hypothetical protein FG07651.1 TREMEDRAFT_31663 similar to hypothetical protein CC1G_09904 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_31632 similar to hypothetical protein TREMEDRAFT_63279 predicted protein TREMEDRAFT_63280 predicted protein TREMEDRAFT_63281 predicted protein TREMEDRAFT_63283 predicted protein TREMEDRAFT_63284 predicted protein TREMEDRAFT_63286 predicted protein TREMEDRAFT_63288 predicted protein TREMEDRAFT_63289 predicted protein TREMEDRAFT_63290 predicted protein TREMEDRAFT_63291 predicted protein TREMEDRAFT_63292 similar to unnamed protein product TREMEDRAFT_63293 similar to hypothetical protein CNBD0040 TREMEDRAFT_32035 similar to hypothetical protein CNBI0060 TREMEDRAFT_63295 predicted protein TREMEDRAFT_63296 predicted protein TREMEDRAFT_63297 predicted protein TREMEDRAFT_63298 predicted protein TREMEDRAFT_63299 predicted protein TREMEDRAFT_63300 predicted protein TREMEDRAFT_74180 similar to hypothetical protein CNBD5820 TREMEDRAFT_63303 predicted protein TREMEDRAFT_63306 similar to hypothetical protein CND00410 TREMEDRAFT_74182 similar to hypothetical protein CND00400 TREMEDRAFT_69217 similar to hypothetical protein TREMEDRAFT_63310 predicted protein TREMEDRAFT_63311 predicted protein TREMEDRAFT_57230 expressed protein TREMEDRAFT_74186 similar to glycolipid mannosyltransferase, putative TREMEDRAFT_74187 similar to glycolipid mannosyltransferase, putative; expressed hypothetical protein TREMEDRAFT_63316 similar to hypothetical protein CNBD5470 TREMEDRAFT_63317 predicted protein TREMEDRAFT_63318 predicted protein TREMEDRAFT_63319 predicted protein TREMEDRAFT_63321 predicted protein TREMEDRAFT_63322 predicted protein TREMEDRAFT_63323 predicted protein TREMEDRAFT_63324 similar to hypothetical protein TREMEDRAFT_71924 similar to small nuclear ribonucleoprotein, putative TREMEDRAFT_32588 similar to protein carrier, putative TREMEDRAFT_63328 predicted protein TREMEDRAFT_32459 similar to hypothetical protein CNBE3390 TREMEDRAFT_32541 similar to Dihydroorotate dehydrogenase, mitochondrial precursor, putative TREMEDRAFT_44603 similar to signal sequence binding protein, putative TREMEDRAFT_44607 similar to phosphopantothenate-cysteine ligase, putative; expressed hypothetical protein TREMEDRAFT_63333 predicted protein TREMEDRAFT_63335 similar to hypothetical protein CIMG_04839 TREMEDRAFT_74192 similar to hypothetical protein CNBE3290 TREMEDRAFT_63337 similar to conserved hypothetical protein TREMEDRAFT_63338 predicted protein TREMEDRAFT_63339 similar to hypothetical protein BC1G_09298 TREMEDRAFT_63340 predicted protein TREMEDRAFT_71929 similar to CG2177-PA; expressed hypothetical protein TREMEDRAFT_15842 similar to hypothetical protein CNBE3170 TREMEDRAFT_32166 similar to hypothetical protein CNBE3160 TREMEDRAFT_63344 similar to predicted protein TREMEDRAFT_44613 similar to hypothetical protein CNBE3250 TREMEDRAFT_32091 similar to potential histone-like transcription factor TREMEDRAFT_17545 similar to ubiquitin conjugating enzyme, putative TREMEDRAFT_69235 similar to hypothetical protein CNE03280 TREMEDRAFT_63349 similar to hypothetical protein CNBE3410 TREMEDRAFT_32489 similar to conserved hypothetical protein TREMEDRAFT_57239 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_57240 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_23720 similar to predicted protein TREMEDRAFT_57242 similar to pheromone maturation-related protein, putative; expressed hypothetical protein TREMEDRAFT_69240 similar to hypothetical protein CNBE3100 TREMEDRAFT_32136 similar to hypothetical protein CNE03080 TREMEDRAFT_18678 similar to hypothetical protein CNBE3050 TREMEDRAFT_63366 predicted protein TREMEDRAFT_63367 predicted protein TREMEDRAFT_63368 similar to hypothetical protein TREMEDRAFT_74205 similar to phospholipid binding protein, putative TREMEDRAFT_63370 similar to hypothetical protein CNBG1510 TREMEDRAFT_57251 similar to hypothetical protein CNBG1520 TREMEDRAFT_32532 similar to hypothetical protein CNBG2200 TREMEDRAFT_63373 similar to hypothetical protein CNG02550 TREMEDRAFT_69256 similar to suppressor of action mutation 2-like protein, putative TREMEDRAFT_69259 similar to hypothetical protein CNBG2150 TREMEDRAFT_32151 similar to hypothetical protein CNBG1500 TREMEDRAFT_32298 similar to hypothetical protein CNBG1490 TREMEDRAFT_63381 predicted protein TREMEDRAFT_44656 similar to glucose-6-P dehydrogenase; expressed hypothetical protein TREMEDRAFT_32384 similar to 2-nitropropane dioxygenase, putative TREMEDRAFT_63385 similar to hypothetical protein CNBH3190 TREMEDRAFT_63386 predicted protein TREMEDRAFT_44659 similar to hypothetical protein CNG02410 TREMEDRAFT_44661 similar to hypothetical protein CNBG3600 TREMEDRAFT_74213 similar to hypothetical protein CNBG3560 TREMEDRAFT_57256 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_63392 predicted protein TREMEDRAFT_63393 similar to submandibular gland mucin TREMEDRAFT_63394 predicted protein TREMEDRAFT_63396 predicted protein TREMEDRAFT_63397 predicted protein TREMEDRAFT_63399 predicted protein TREMEDRAFT_63400 predicted protein TREMEDRAFT_63402 predicted protein TREMEDRAFT_57257 expressed protein TREMEDRAFT_63404 Putative wc-2 TREMEDRAFT_32574 similar to hypothetical protein CNBG2770 TREMEDRAFT_71946 similar to phosphatase associated protein, putative TREMEDRAFT_63408 similar to transcriptional activator, putative TREMEDRAFT_63409 predicted protein TREMEDRAFT_63411 predicted protein TREMEDRAFT_63417 predicted protein TREMEDRAFT_63418 predicted protein TREMEDRAFT_63419 similar to hypothetical protein TREMEDRAFT_63420 similar to hypothetical protein CNBG2090 TREMEDRAFT_32301 similar to hypothetical protein CNC02430 TREMEDRAFT_63422 similar to predicted protein TREMEDRAFT_57259 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_63424 similar to Skn7 TREMEDRAFT_63425 similar to hypothetical protein CNG01760 TREMEDRAFT_63426 predicted protein TREMEDRAFT_32410 similar to mitochondrion protein, putative TREMEDRAFT_32328 similar to pre-mRNA splicing factor, putative TREMEDRAFT_39775 expressed protein TREMEDRAFT_18378 similar to predicted protein TREMEDRAFT_44669 similar to hypothetical protein CNBG2450 TREMEDRAFT_71949 expressed protein TREMEDRAFT_69277 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_16478 similar to hypothetical protein CNBH3940 TREMEDRAFT_69280 Probable beta-glucosidase TREMEDRAFT_44677 similar to phosphatidylserine decarboxylase 1 precursor, putative TREMEDRAFT_74226 similar to hypothetical protein CNBG2270 TREMEDRAFT_63441 similar to hypothetical protein CNBG2340 TREMEDRAFT_63442 similar to hypothetical protein TREMEDRAFT_32267 similar to hypothetical protein CNBC3120 TREMEDRAFT_63444 similar to hypothetical protein OsJ_035485 TREMEDRAFT_63445 similar to hypothetical protein CNBC1040 TREMEDRAFT_63449 predicted protein TREMEDRAFT_63451 similar to predicted protein TREMEDRAFT_32275 similar to hypothetical protein CNBG3060 TREMEDRAFT_63454 predicted protein TREMEDRAFT_69291 similar to hypothetical protein CNBG2500 TREMEDRAFT_16645 similar to hypothetical protein CNBG2510 TREMEDRAFT_63457 similar to hypothetical protein TREMEDRAFT_63460 predicted protein TREMEDRAFT_32155 similar to pria protein precursor, putative TREMEDRAFT_63462 similar to hypothetical protein PGUG_05176 TREMEDRAFT_32403 similar to hypothetical protein MGG_00309 TREMEDRAFT_32353 similar to hypothetical protein CNA04260 TREMEDRAFT_63465 similar to unnamed protein product TREMEDRAFT_63466 predicted protein TREMEDRAFT_71960 expressed protein TREMEDRAFT_63470 predicted protein TREMEDRAFT_19613 similar to hypothetical protein CNBC3570 TREMEDRAFT_63472 predicted protein TREMEDRAFT_63473 similar to hypothetical protein CNBG2400 TREMEDRAFT_69302 similar to hypothetical protein CNBG2390 TREMEDRAFT_63476 predicted protein TREMEDRAFT_63477 similar to UDP-glucose glucosyltransferase TREMEDRAFT_15648 similar to hypothetical protein CNG01390 TREMEDRAFT_63481 predicted protein TREMEDRAFT_63482 predicted protein TREMEDRAFT_63483 predicted protein TREMEDRAFT_63484 predicted protein TREMEDRAFT_63485 predicted protein TREMEDRAFT_63488 similar to pH-response regulator protein palA/RIM20 TREMEDRAFT_63490 predicted protein TREMEDRAFT_63491 predicted protein TREMEDRAFT_63492 similar to predicted protein TREMEDRAFT_63493 predicted protein TREMEDRAFT_63494 similar to hypothetical protein CNBG2430 TREMEDRAFT_32188 similar to hypothetical protein CNBG4430 TREMEDRAFT_71966 similar to hypothetical protein CNBG3410 TREMEDRAFT_63496 similar to hypothetical protein CNBG4720 TREMEDRAFT_74241 similar to hypothetical protein CNG01360 TREMEDRAFT_63499 predicted protein TREMEDRAFT_63501 predicted protein TREMEDRAFT_71970 similar to hypothetical protein CNG00490 TREMEDRAFT_63504 predicted protein TREMEDRAFT_39832 similar to chitin deacetylase-like mannoprotein MP98; expressed hypothetical protein TREMEDRAFT_44723 similar to hypothetical protein CNBG4560 TREMEDRAFT_39838 similar to hypothetical protein CC1G_11035 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_32323 similar to hypothetical protein CNBG3890 TREMEDRAFT_63511 similar to calcineurin temperature suppressor Cts1 TREMEDRAFT_69323 similar to hypothetical protein CNBG4120 TREMEDRAFT_63513 predicted protein TREMEDRAFT_32562 similar to hypothetical protein CNBG3990 TREMEDRAFT_63516 similar to hypothetical protein An11g01660 TREMEDRAFT_63518 predicted protein TREMEDRAFT_71976 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_63520 predicted protein TREMEDRAFT_63521 predicted protein TREMEDRAFT_63523 predicted protein TREMEDRAFT_63524 similar to predicted protein TREMEDRAFT_63525 predicted protein TREMEDRAFT_32222 similar to hypothetical protein CNBJ0280 TREMEDRAFT_32090 similar to hypothetical protein CNBG2880 TREMEDRAFT_63529 similar to unnamed protein product TREMEDRAFT_74255 similar to cyclin; expressed hypothetical protein TREMEDRAFT_63531 predicted protein TREMEDRAFT_14527 similar to ligand-regulated transcription factor, putative; expressed hypothetical protein TREMEDRAFT_57301 expressed protein TREMEDRAFT_44744 similar to hypothetical protein CNBG2490 TREMEDRAFT_32184 similar to hypothetical protein CNG02260 TREMEDRAFT_32480 similar to hypothetical protein CC1G_03254 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_32134 similar to nucleus protein, putative TREMEDRAFT_69333 similar to hypothetical protein CNBG2830 TREMEDRAFT_63540 predicted protein TREMEDRAFT_63541 predicted protein TREMEDRAFT_32525 similar to microtubule motor, putative TREMEDRAFT_32501 similar to hypothetical protein CNBG3370 TREMEDRAFT_74261 predicted protein TREMEDRAFT_69337 similar to hypothetical protein CNBG3190 TREMEDRAFT_63547 similar to conserved hypothetical protein TREMEDRAFT_32205 similar to hypothetical protein CNBG2420 TREMEDRAFT_74262 expressed protein TREMEDRAFT_63550 predicted protein TREMEDRAFT_63555 predicted protein TREMEDRAFT_63556 predicted protein TREMEDRAFT_63557 predicted protein TREMEDRAFT_63559 similar to phosphoglycerate dehydrogenase TREMEDRAFT_39872 similar to conserved hypothetical protein TREMEDRAFT_57311 similar to mannitol-1-phosphate dehydrogenase; expressed hypothetical protein TREMEDRAFT_63566 similar to conserved hypothetical protein TREMEDRAFT_32149 similar to hypothetical protein CNBF0180 TREMEDRAFT_69350 similar to conserved hypothetical protein TREMEDRAFT_32173 similar to hypothetical protein CC1G_00426 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_57317 expressed protein TREMEDRAFT_63571 predicted protein TREMEDRAFT_32236 similar to hypothetical protein DEHA0G11264g TREMEDRAFT_63574 similar to hypothetical protein CNBG2680 TREMEDRAFT_20787 similar to hypothetical protein CNBG2670 TREMEDRAFT_63576 similar to specific transcriptional repressor, putative TREMEDRAFT_32575 similar to conserved hypothetical protein TREMEDRAFT_74272 similar to chimeric spermidine synthase/saccharopine dehydrogenase; expressed hypothetical protein TREMEDRAFT_32135 similar to uridine kinase, putative TREMEDRAFT_71988 similar to hypothetical protein CNBG2630 TREMEDRAFT_32556 similar to hypothetical protein CNK02980 TREMEDRAFT_63582 similar to hypothetical protein CNG01010 TREMEDRAFT_74274 similar to hypothetical protein CNG00980 TREMEDRAFT_16396 similar to hypothetical protein CNBG4220 TREMEDRAFT_63586 multi-copper oxidase; laccase-like; related to enzymes acting in melanin synthesis TREMEDRAFT_95285 putative multi-copper oxidase; laccase-like; similar to enzymes acting in melanin-synthesis TREMEDRAFT_71991 expressed protein TREMEDRAFT_63589 similar to predicted protein TREMEDRAFT_71992 similar to hypothetical protein CNBG4020 TREMEDRAFT_74278 expressed protein TREMEDRAFT_57326 expressed protein TREMEDRAFT_19618 similar to hypothetical protein CNBG3830 TREMEDRAFT_71994 expressed protein TREMEDRAFT_39893 similar to transport protein particle complex subunit; expressed hypothetical protein TREMEDRAFT_63595 similar to hypothetical protein TREMEDRAFT_63596 predicted protein TREMEDRAFT_63597 similar to predicted protein TREMEDRAFT_63598 predicted protein TREMEDRAFT_63599 predicted protein TREMEDRAFT_44779 similar to arginase, putative; expressed hypothetical protein TREMEDRAFT_74282 predicted protein TREMEDRAFT_74285 similar to hypothetical protein CNG02050 TREMEDRAFT_63605 similar to hypothetical protein CNG02060 TREMEDRAFT_69371 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_74287 similar to metalloreductase, putative TREMEDRAFT_63608 predicted protein TREMEDRAFT_63609 predicted protein TREMEDRAFT_63610 similar to hypothetical protein CIMG_04839 TREMEDRAFT_63612 predicted protein TREMEDRAFT_63614 predicted protein TREMEDRAFT_63615 similar to ENOD2 TREMEDRAFT_57333 expressed protein TREMEDRAFT_72000 expressed protein TREMEDRAFT_18004 similar to hypothetical protein CNBG3610 TREMEDRAFT_44788 similar to polyamine transport-related protein, putative; expressed hypothetical protein TREMEDRAFT_23680 similar to predicted protein TREMEDRAFT_63622 predicted protein TREMEDRAFT_63623 predicted protein TREMEDRAFT_32321 similar to pyruvate dehydrogenase protein x component, mitochondrial precursor, putative; expressed hypothetical protein TREMEDRAFT_69380 similar to hypothetical protein CNBG4070 TREMEDRAFT_69381 similar to hypothetical protein TREMEDRAFT_24045 similar to hypothetical protein PGUG_01395 TREMEDRAFT_32307 similar to conserved hypothetical protein TREMEDRAFT_63629 similar to conserved hypothetical protein TREMEDRAFT_32078 similar to hypothetical protein CNG00810 TREMEDRAFT_63631 similar to hypothetical protein CNG00820 TREMEDRAFT_63632 predicted protein TREMEDRAFT_63633 predicted protein TREMEDRAFT_63634 predicted protein TREMEDRAFT_63637 predicted protein TREMEDRAFT_18044 similar to hypothetical protein CNBG3760 TREMEDRAFT_69388 similar to hypothetical protein CNBG3750 TREMEDRAFT_69390 similar to hypothetical protein CNBG3730 TREMEDRAFT_63643 predicted protein TREMEDRAFT_63646 predicted protein TREMEDRAFT_63647 predicted protein TREMEDRAFT_63650 similar to proteophosphoglycan TREMEDRAFT_63652 predicted protein TREMEDRAFT_63654 similar to hypothetical protein CIMG_04839 TREMEDRAFT_63655 predicted protein TREMEDRAFT_63657 predicted protein TREMEDRAFT_69393 similar to hypothetical protein CNBF1830 TREMEDRAFT_63659 predicted protein TREMEDRAFT_63660 predicted protein TREMEDRAFT_63661 predicted protein TREMEDRAFT_32435 similar to hypothetical protein CNBG4540 TREMEDRAFT_72012 expressed protein TREMEDRAFT_44814 similar to hypothetical protein CNBG4570 TREMEDRAFT_69397 similar to hypothetical protein CNBG4410 TREMEDRAFT_63665 similar to hypothetical protein CNBG3460 TREMEDRAFT_63666 similar to RWD domain-containing protein TREMEDRAFT_63667 similar to hypothetical protein CNBG3400 TREMEDRAFT_63668 predicted protein TREMEDRAFT_63669 predicted protein TREMEDRAFT_63670 predicted protein TREMEDRAFT_63671 predicted protein TREMEDRAFT_63672 predicted protein TREMEDRAFT_63673 predicted protein TREMEDRAFT_63675 predicted protein TREMEDRAFT_63677 predicted protein TREMEDRAFT_32284 similar to hypothetical protein CHGG_01728 TREMEDRAFT_69401 similar to conserved hypothetical protein TREMEDRAFT_63682 predicted protein TREMEDRAFT_74299 similar to hypothetical protein CNBI3220 TREMEDRAFT_32838 similar to hypothetical protein CNBI3170 TREMEDRAFT_14959 similar to hypothetical protein CNBA4130 TREMEDRAFT_74300 similar to conserved hypothetical protein TREMEDRAFT_69404 similar to hypothetical protein CNBA3780 TREMEDRAFT_39940 similar to hypothetical protein CNBA3760 TREMEDRAFT_18845 similar to hypothetical protein CNBI3150 TREMEDRAFT_63691 similar to hypothetical protein CNBI3140 TREMEDRAFT_72015 similar to protein serine/threonine kinase, putative TREMEDRAFT_57345 similar to protein kinase, putative; expressed hypothetical protein TREMEDRAFT_69409 similar to hypothetical protein CNK02330 TREMEDRAFT_63696 predicted protein TREMEDRAFT_63698 similar to hypothetical protein CNBK1230; Rad57 TREMEDRAFT_63699 similar to hypothetical protein CNBK1040 TREMEDRAFT_74307 similar to hypothetical protein CNK02450 TREMEDRAFT_63702 putative multi-copper oxidase; laccase-like; related to ascorbate oxidases TREMEDRAFT_63703 similar to hypothetical protein CNK02390 TREMEDRAFT_63705 predicted protein TREMEDRAFT_74309 similar to general transcriptional repressor, putative TREMEDRAFT_63707 similar to hypothetical protein CNBK0860 TREMEDRAFT_32810 similar to cytoplasm protein, putative TREMEDRAFT_69418 similar to hypothetical protein CNBK1010 TREMEDRAFT_39966 similar to nucleus protein, putative TREMEDRAFT_63713 predicted protein TREMEDRAFT_44848 similar to aldehyde reductase i, putative; expressed hypothetical protein TREMEDRAFT_32705 similar to hypothetical protein CNBK1200 TREMEDRAFT_74315 similar to peroxisome targeting signal receptor, putative; expressed hypothetical protein TREMEDRAFT_57355 expressed protein TREMEDRAFT_44851 similar to prephenate dehydrogenase, putative; expressed hypothetical protein TREMEDRAFT_57358 expressed protein TREMEDRAFT_63724 predicted protein TREMEDRAFT_63725 predicted protein TREMEDRAFT_69428 similar to conserved hypothetical protein TREMEDRAFT_63727 similar to myeloid/lymphoid or mixed-lineage leukemia 5 TREMEDRAFT_32941 similar to hypothetical protein CNBK0400 TREMEDRAFT_63728 similar to hypothetical protein CNBK0410 TREMEDRAFT_32602 similar to hypothetical protein CNBA2950 TREMEDRAFT_72031 similar to hypothetical protein CNBG4170 TREMEDRAFT_57361 expressed protein TREMEDRAFT_63732 predicted protein TREMEDRAFT_63733 predicted protein TREMEDRAFT_63734 predicted protein TREMEDRAFT_63735 predicted protein TREMEDRAFT_44861 similar to protein binding protein, putative; expressed hypothetical protein TREMEDRAFT_21150 Putative 6-4 photolyase TREMEDRAFT_44862 similar to protein N-terminal asparagine amidohydrolase, putative; expressed hypothetical protein TREMEDRAFT_32993 similar to hypothetical protein CNE03870 TREMEDRAFT_33014 similar to hypothetical protein CNBL1230 TREMEDRAFT_32751 similar to hypothetical protein CNBK0890 TREMEDRAFT_63743 predicted protein TREMEDRAFT_39992 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_32866 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_39997 similar to hypothetical protein CNBK0830 TREMEDRAFT_63747 predicted protein TREMEDRAFT_32868 similar to hypothetical protein CNBA1210 TREMEDRAFT_57371 similar to Zinc finger, CCHC-type; expressed hypothetical protein TREMEDRAFT_40008 similar to mismatch repair-related protein, putative; expressed hypothetical protein TREMEDRAFT_63752 similar to hypothetical protein CNBK0950 TREMEDRAFT_74332 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_63755 predicted protein TREMEDRAFT_74333 similar to helicase, putative TREMEDRAFT_63757 predicted protein TREMEDRAFT_63758 similar to hypothetical protein PICST_30161 TREMEDRAFT_63759 predicted protein TREMEDRAFT_63760 predicted protein TREMEDRAFT_63762 similar to hypothetical protein CIMG_04839 TREMEDRAFT_63764 predicted protein TREMEDRAFT_63765 predicted protein TREMEDRAFT_33081 similar to hypothetical protein An01g00270 TREMEDRAFT_57375 expressed protein TREMEDRAFT_74335 similar to hypothetical protein CNBK0730 TREMEDRAFT_63769 predicted protein TREMEDRAFT_72042 similar to protein kinase kin1, putative TREMEDRAFT_18577 similar to hypothetical protein CNBK0780 TREMEDRAFT_32639 similar to hypothetical protein CNBK0740 TREMEDRAFT_63772 similar to hypothetical protein CNBA4490 TREMEDRAFT_40019 similar to transaldolase, putative; expressed hypothetical protein TREMEDRAFT_44888 similar to hypothetical protein CNBK0280 TREMEDRAFT_33167 similar to hypothetical protein TREMEDRAFT_33037 Putative phytochrome TREMEDRAFT_44893 similar to hypothetical protein CNK03150 TREMEDRAFT_63780 similar to hypothetical protein CND04610 TREMEDRAFT_63782 predicted protein TREMEDRAFT_63783 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_63784 similar to hypothetical protein CNK00450 TREMEDRAFT_63785 predicted protein TREMEDRAFT_32601 similar to hypothetical protein CNBK0980 TREMEDRAFT_32672 similar to predicted protein TREMEDRAFT_63790 similar to hypothetical protein CNBB4670 TREMEDRAFT_44913 similar to hypothetical protein CNBK0600 TREMEDRAFT_63794 predicted protein TREMEDRAFT_32861 similar to mitotic chromosome condensation-related protein, putative TREMEDRAFT_33158 similar to hypothetical protein CNK02790 TREMEDRAFT_69466 similar to hypothetical protein CNBK2960 TREMEDRAFT_32733 similar to hypothetical protein CNBA6120 TREMEDRAFT_63800 predicted protein TREMEDRAFT_33160 similar to hypothetical protein CNBK2500 TREMEDRAFT_32628 similar to Subunit (17 kDa) of TFIID and SAGA complexes, involved in RNA polymerase II transcription initiation and in chromatin modification, similar to histone H3 TREMEDRAFT_63804 similar to hypothetical protein CNK01020 TREMEDRAFT_74351 similar to hypothetical protein UM04719.1 TREMEDRAFT_63806 similar to hypothetical protein CNK01240 TREMEDRAFT_63809 similar to hypothetical protein CNBK2300 TREMEDRAFT_33113 similar to beta-glucosidase TREMEDRAFT_63811 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_63812 similar to unnamed protein product TREMEDRAFT_63813 similar to unnamed protein product TREMEDRAFT_63814 similar to conserved hypothetical protein TREMEDRAFT_63815 similar to conserved hypothetical protein TREMEDRAFT_57395 similar to putative methyltransferase; expressed hypothetical protein TREMEDRAFT_72060 similar to cytoplasm protein, putative TREMEDRAFT_63820 similar to hypothetical protein TREMEDRAFT_63821 predicted protein TREMEDRAFT_44940 similar to DJ-1/PfpI family protein; expressed hypothetical protein TREMEDRAFT_32709 similar to hypothetical protein CNK00610 TREMEDRAFT_32854 similar to hypothetical protein CNBK3150 TREMEDRAFT_32669 similar to hypothetical protein CNBK2660 TREMEDRAFT_63828 predicted protein TREMEDRAFT_63829 similar to Putative protein TPRXL TREMEDRAFT_40084 similar to endocytosis-related protein, putative; expressed hypothetical protein TREMEDRAFT_72066 similar to hypothetical protein CNBK3130 TREMEDRAFT_14304 similar to hypothetical protein CNBK2920 TREMEDRAFT_63833 similar to dentin sialophosphoprotein TREMEDRAFT_63836 predicted protein TREMEDRAFT_23729 similar to PPID protein TREMEDRAFT_33066 similar to hypothetical protein CNBH1720 TREMEDRAFT_63840 predicted protein TREMEDRAFT_63841 similar to gastric mucin TREMEDRAFT_69493 similar to hypothetical protein CNBK3200 TREMEDRAFT_63843 similar to ENSANGP00000029682 TREMEDRAFT_74367 similar to RNA-binding protein sce3, putative; expressed hypothetical protein TREMEDRAFT_33090 similar to predicted protein TREMEDRAFT_63846 similar to hypothetical protein CNBK1550 TREMEDRAFT_72070 similar to hypothetical protein CNBK1870 TREMEDRAFT_44965 similar to hypothetical protein CNBK1860 TREMEDRAFT_69498 similar to hypothetical protein An12g05070 TREMEDRAFT_33125 similar to hypothetical protein CNBA0210 TREMEDRAFT_32780 similar to unnamed protein product TREMEDRAFT_32771 similar to hypothetical protein CHGG_04057 TREMEDRAFT_63853 predicted protein TREMEDRAFT_63854 similar to hypothetical protein CNBK1970 TREMEDRAFT_11764 similar to hypothetical protein CNBK1910 TREMEDRAFT_63857 similar to hypothetical protein CNK01850 TREMEDRAFT_44967 similar to hypothetical protein CNBK1680 TREMEDRAFT_69505 similar to hypothetical protein CNBC2300 TREMEDRAFT_57409 expressed protein TREMEDRAFT_33109 similar to hypothetical protein CNK02200 TREMEDRAFT_63862 predicted protein TREMEDRAFT_63863 predicted protein TREMEDRAFT_63864 similar to hypothetical protein CNBG1940 TREMEDRAFT_63865 similar to hypothetical protein CNBK2150 TREMEDRAFT_33031 similar to hypothetical protein CNBK1760 TREMEDRAFT_63867 similar to pepsinogen A [turtles, Peptide, 361 aa] TREMEDRAFT_40107 similar to hypothetical protein CNBK1960 TREMEDRAFT_40112 similar to Pre-mRNA-splicing factor CEF1; expressed hypothetical protein TREMEDRAFT_74374 similar to Histone-lysine N-methyltransferase, H3 lysine-79 specific (Histone H3-K79 methyltransferase) (H3-K79-HMTase) TREMEDRAFT_18635 similar to grpe protein, putative TREMEDRAFT_63872 similar to hypothetical protein CNK02210 TREMEDRAFT_63873 predicted protein TREMEDRAFT_63874 similar to hypothetical protein CNBK2020 TREMEDRAFT_69512 similar to hypothetical protein CNBK2030 TREMEDRAFT_63876 similar to hypothetical protein CNBK2040 TREMEDRAFT_32598 similar to hypothetical protein CNBK2040 TREMEDRAFT_63878 predicted protein TREMEDRAFT_63879 predicted protein TREMEDRAFT_63880 predicted protein TREMEDRAFT_63881 predicted protein TREMEDRAFT_63882 predicted protein TREMEDRAFT_74376 similar to hypothetical protein CNBK2060 TREMEDRAFT_63885 predicted protein TREMEDRAFT_18081 similar to hypothetical protein CNBB0610 TREMEDRAFT_63889 predicted protein TREMEDRAFT_44982 similar to eukaryotic translation initiation factor 3 subunit EifCg, putative; expressed hypothetical protein TREMEDRAFT_33084 similar to hypothetical protein CNBK2460 TREMEDRAFT_63892 similar to threonine ammonia-lyase, putative TREMEDRAFT_44986 similar to hypothetical protein CNK01410 TREMEDRAFT_63894 predicted protein TREMEDRAFT_63895 predicted protein TREMEDRAFT_63898 predicted protein TREMEDRAFT_69521 similar to hypothetical protein CNBK2130 TREMEDRAFT_63900 predicted protein TREMEDRAFT_13793 similar to hypothetical protein CNBK2470 TREMEDRAFT_15554 similar to hypothetical protein CNBK2190 TREMEDRAFT_63904 similar to hypothetical protein AFUB_050870 TREMEDRAFT_74383 expressed protein TREMEDRAFT_72084 similar to hypothetical protein CNBK2220 TREMEDRAFT_32699 similar to hypothetical protein CNBK2210 TREMEDRAFT_57424 similar to endo-1,3(4)-beta-glucanase, putative; expressed hypothetical protein TREMEDRAFT_63910 similar to ER to Golgi transport-related protein, putative TREMEDRAFT_33168 similar to hypothetical protein CNBK2100 TREMEDRAFT_63912 predicted protein TREMEDRAFT_63913 similar to unnamed protein product TREMEDRAFT_63914 predicted protein TREMEDRAFT_63916 similar to hypothetical protein CNBK2170 TREMEDRAFT_63917 similar to hypothetical protein CC1G_06815 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_74387 expressed protein TREMEDRAFT_63919 predicted protein TREMEDRAFT_69531 similar to hypothetical protein CNBK2410 TREMEDRAFT_63921 predicted protein TREMEDRAFT_69533 similar to hypothetical protein CNBK2430 TREMEDRAFT_63924 similar to hypothetical protein CNK01060 TREMEDRAFT_63926 predicted protein TREMEDRAFT_63927 similar to predicted protein TREMEDRAFT_63928 similar to hypothetical protein CNBG1940 TREMEDRAFT_69535 similar to hypothetical protein CNBK2340 TREMEDRAFT_69537 similar to conserved hypothetical protein TREMEDRAFT_63934 predicted protein TREMEDRAFT_63936 similar to hypothetical protein CIMG_04839 TREMEDRAFT_63937 similar to hypothetical protein CIMG_04839 TREMEDRAFT_63938 similar to hypothetical protein CNBC1040 TREMEDRAFT_63940 predicted protein TREMEDRAFT_63941 predicted protein TREMEDRAFT_63942 predicted protein TREMEDRAFT_15378 similar to hypothetical protein CNBK2520 TREMEDRAFT_63945 similar to hypothetical protein CNBH0650 TREMEDRAFT_32680 similar to beta DNA polymerase, putative TREMEDRAFT_63948 similar to conserved hypothetical protein TREMEDRAFT_16698 similar to hypothetical protein CNBA6090 TREMEDRAFT_22632 similar to sexual development protein (LsdA), putative TREMEDRAFT_74394 similar to 8-amino-7-oxononanoatesynthase, putative; expressed hypothetical protein TREMEDRAFT_40155 similar to hypothetical protein CNBJ2630 TREMEDRAFT_32707 similar to hypothetical protein CC1G_00246 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_74398 similar to long-chain-fatty-acid--CoA ligase, putative; expressed hypothetical protein TREMEDRAFT_18853 similar to hypothetical protein CNBD5150 TREMEDRAFT_63958 predicted protein TREMEDRAFT_63959 similar to hypothetical protein CNK02530 TREMEDRAFT_40163 similar to cytoplasm protein, putative; expressed hypothetical protein TREMEDRAFT_69554 similar to hypothetical protein CNBC3720 TREMEDRAFT_32879 similar to hypothetical protein AN6113.2; expressed hypothetical protein TREMEDRAFT_32925 similar to predicted protein TREMEDRAFT_40176 similar to vacuole protein, putative; expressed hypothetical protein TREMEDRAFT_33072 similar to hypothetical protein CNBA3100 TREMEDRAFT_63970 similar to CAP1 TREMEDRAFT_32877 similar to UDP-galactose transporter homolog 1 TREMEDRAFT_63973 predicted protein TREMEDRAFT_63976 predicted protein TREMEDRAFT_63977 predicted protein TREMEDRAFT_74407 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_33136 similar to hypothetical protein CNBN1170 TREMEDRAFT_45044 similar to tricarboxylic acid cycle-related protein, putative TREMEDRAFT_45046 similar to choline-phosphate cytidylyltransferase, putative; expressed hypothetical protein TREMEDRAFT_40191 similar to hypothetical protein CNBC2570 TREMEDRAFT_63984 predicted protein TREMEDRAFT_63985 predicted protein TREMEDRAFT_63987 predicted protein TREMEDRAFT_63988 predicted protein TREMEDRAFT_63990 predicted protein TREMEDRAFT_63992 predicted protein TREMEDRAFT_63993 predicted protein TREMEDRAFT_63995 predicted protein TREMEDRAFT_69568 similar to hypothetical protein CNBB2670 TREMEDRAFT_32917 similar to hypothetical protein CNBF1310 TREMEDRAFT_32898 similar to dihydroxyacetone kinase 1, putative; expressed hypothetical protein TREMEDRAFT_40211 similar to protein-binding protein, putative; expressed hypothetical protein TREMEDRAFT_69573 similar to hypothetical protein CNBA8120 TREMEDRAFT_33000 similar to predicted protein TREMEDRAFT_69576 similar to hypothetical protein CNBA2420 TREMEDRAFT_69577 similar to oxidoreductase, putative TREMEDRAFT_64009 predicted protein TREMEDRAFT_64011 predicted protein TREMEDRAFT_74418 predicted protein TREMEDRAFT_74420 similar to hypothetical protein SS1G_07897 TREMEDRAFT_33145 similar to hypothetical protein CNBJ0220 TREMEDRAFT_64022 predicted protein TREMEDRAFT_64023 predicted protein TREMEDRAFT_64024 predicted protein TREMEDRAFT_64026 predicted protein TREMEDRAFT_64027 predicted protein TREMEDRAFT_64028 predicted protein TREMEDRAFT_69584 similar to anion transporter, putative TREMEDRAFT_69585 similar to S-adenosylmethionine transporter, putative TREMEDRAFT_64031 predicted protein TREMEDRAFT_74426 predicted protein TREMEDRAFT_57461 expressed protein TREMEDRAFT_64036 predicted protein TREMEDRAFT_72119 expressed protein TREMEDRAFT_57462 expressed protein TREMEDRAFT_74429 similar to fatty acid-2 hydroxylase; expressed hypothetical protein TREMEDRAFT_33152 similar to Mannose-6-phosphate isomerase (Phosphomannose isomerase) (PMI) (Phosphohexomutase) TREMEDRAFT_32940 similar to hypothetical protein CNBA5260 TREMEDRAFT_74430 similar to hypothetical protein CNBL3040 TREMEDRAFT_69593 similar to hypothetical protein CNBK2330 TREMEDRAFT_69594 similar to hypothetical protein CNBD4950 TREMEDRAFT_64044 similar to hypothetical protein CNBC0510 TREMEDRAFT_69595 similar to Peptidyl-prolyl cis-trans isomerase-like 2 (PPIase) (Rotamase) (Cyclophilin-60) (Cyclophilin-like protein Cyp-60) TREMEDRAFT_74431 similar to hypothetical protein CNBM1560 TREMEDRAFT_64047 similar to hypothetical protein MGG_05828 TREMEDRAFT_72123 similar to chitin deacetylase Cda1; expressed hypothetical protein TREMEDRAFT_33043 similar to hypothetical protein NCU01089 TREMEDRAFT_64052 predicted protein TREMEDRAFT_64054 similar to zinc finger, CCHC domain containing 5 TREMEDRAFT_64055 similar to hypothetical protein 26.t00109 TREMEDRAFT_64057 predicted protein TREMEDRAFT_64058 predicted protein TREMEDRAFT_74434 similar to hypothetical protein CNBD2190 TREMEDRAFT_40234 similar to Pol II transcription elongation factor, putative TREMEDRAFT_64061 predicted protein TREMEDRAFT_64062 predicted protein TREMEDRAFT_64064 predicted protein TREMEDRAFT_69602 similar to hypothetical protein CNBD2110 TREMEDRAFT_64066 similar to hypothetical protein CNBN1770 TREMEDRAFT_64068 similar to hypothetical protein CC1G_04071 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_45103 similar to Na+/H+ exchanger AnNHA1, putative TREMEDRAFT_64076 predicted protein TREMEDRAFT_33397 similar to hypothetical protein CNBN1660 TREMEDRAFT_33512 similar to hypothetical protein CNBN2190 TREMEDRAFT_69611 similar to predicted protein TREMEDRAFT_64080 similar to hypothetical protein CNBE4470 TREMEDRAFT_33585 similar to hypothetical protein CNBD1780 TREMEDRAFT_33288 similar to hypothetical protein CND04530 TREMEDRAFT_33222 similar to hypothetical protein CNBN0920 TREMEDRAFT_69614 similar to conserved hypothetical protein TREMEDRAFT_64085 similar to hypothetical protein CNBN0950 TREMEDRAFT_64086 predicted protein TREMEDRAFT_64087 predicted protein TREMEDRAFT_64088 predicted protein TREMEDRAFT_64089 predicted protein TREMEDRAFT_64090 predicted protein TREMEDRAFT_64091 predicted protein TREMEDRAFT_64092 predicted protein TREMEDRAFT_64095 predicted protein TREMEDRAFT_33355 similar to hypothetical protein CNBN1040 TREMEDRAFT_64098 similar to hypothetical protein CNBN0890 TREMEDRAFT_69617 similar to vacuolar membrane protein, putative TREMEDRAFT_64100 similar to hypothetical protein CNBN0960 TREMEDRAFT_64101 similar to hypothetical protein CIMG_04839 TREMEDRAFT_64103 predicted protein TREMEDRAFT_64104 predicted protein TREMEDRAFT_64105 predicted protein TREMEDRAFT_64107 predicted protein TREMEDRAFT_64110 predicted protein TREMEDRAFT_64111 predicted protein TREMEDRAFT_64112 predicted protein TREMEDRAFT_64113 similar to predicted protein TREMEDRAFT_45109 similar to hypothetical protein CNBN1060 TREMEDRAFT_18995 similar to cytochrome b5 reductase 4 TREMEDRAFT_33359 similar to hypothetical protein CNBN1090 TREMEDRAFT_64117 predicted protein TREMEDRAFT_64118 predicted protein TREMEDRAFT_64120 predicted protein TREMEDRAFT_64121 predicted protein TREMEDRAFT_64123 predicted protein TREMEDRAFT_64125 predicted protein TREMEDRAFT_69622 similar to hypothetical protein CNBN1160 TREMEDRAFT_72130 similar to hypothetical protein CNBN1150 TREMEDRAFT_64128 predicted protein TREMEDRAFT_33407 similar to hypothetical protein CNBN1100 TREMEDRAFT_64131 similar to hypothetical protein CNBN1000 TREMEDRAFT_33468 similar to hypothetical protein CNBN0910 TREMEDRAFT_64133 similar to hypothetical protein CNN00840 TREMEDRAFT_33306 similar to hypothetical protein CNBN0840 TREMEDRAFT_33390 similar to hypothetical protein CNBN1180 TREMEDRAFT_64136 predicted protein TREMEDRAFT_64137 predicted protein TREMEDRAFT_64138 predicted protein TREMEDRAFT_64139 predicted protein TREMEDRAFT_64140 similar to unnamed protein product TREMEDRAFT_33242 similar to predicted protein TREMEDRAFT_33225 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_64143 similar to hypothetical protein CNBD1830 TREMEDRAFT_64145 similar to hypothetical protein CNBD1850 TREMEDRAFT_64146 similar to hypothetical protein CNBC2970 TREMEDRAFT_64147 similar to hypothetical protein CNC04220 TREMEDRAFT_69630 similar to response to pH-related protein, putative TREMEDRAFT_33244 similar to conserved hypothetical protein TREMEDRAFT_74447 expressed protein TREMEDRAFT_64151 predicted protein TREMEDRAFT_64152 predicted protein TREMEDRAFT_64153 predicted protein TREMEDRAFT_64154 predicted protein TREMEDRAFT_64156 similar to hypothetical protein CC1G_06447 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64159 predicted protein TREMEDRAFT_64160 predicted protein TREMEDRAFT_64161 predicted protein TREMEDRAFT_64163 predicted protein TREMEDRAFT_64164 similar to hypothetical protein CIMG_04839 TREMEDRAFT_64166 predicted protein TREMEDRAFT_64167 similar to hypothetical protein CIMG_04839 TREMEDRAFT_33472 similar to hypothetical protein CNBN0430 TREMEDRAFT_74448 similar to hypothetical protein An01g09800 TREMEDRAFT_64170 predicted protein TREMEDRAFT_74449 similar to hypothetical protein CNBN0420 TREMEDRAFT_74451 similar to hypothetical protein CNBN0470 TREMEDRAFT_33562 similar to hypothetical protein CNBD1800 TREMEDRAFT_64176 similar to hypothetical protein CNB04830 TREMEDRAFT_64177 similar to hypothetical protein RRC7 TREMEDRAFT_69637 similar to hypothetical protein CND04450 TREMEDRAFT_64179 predicted protein TREMEDRAFT_64181 predicted protein TREMEDRAFT_64182 predicted protein TREMEDRAFT_64184 predicted protein TREMEDRAFT_64186 predicted protein TREMEDRAFT_33211 similar to hypothetical protein CNN01270 TREMEDRAFT_33527 similar to hydrolase, putative TREMEDRAFT_64192 predicted protein TREMEDRAFT_64193 similar to unnamed protein product TREMEDRAFT_64194 predicted protein TREMEDRAFT_72142 expressed protein TREMEDRAFT_64196 similar to hypothetical protein CNBN0170 TREMEDRAFT_64197 predicted protein TREMEDRAFT_64199 similar to hypothetical protein TREMEDRAFT_33448 similar to conserved hypothetical protein TREMEDRAFT_33542 similar to glucan 1,3 beta-glucosidase protein putative TREMEDRAFT_33221 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_64204 similar to hypothetical protein CNBN0180 TREMEDRAFT_64205 predicted protein TREMEDRAFT_64207 similar to hypothetical protein CNN00320 TREMEDRAFT_64208 similar to hypothetical protein CNBN0380 TREMEDRAFT_64209 similar to hypothetical protein SNOG_07249 TREMEDRAFT_64210 predicted protein TREMEDRAFT_13984 similar to hypothetical protein CNN00790 TREMEDRAFT_45154 similar to SUMO activating enzyme, putative; expressed hypothetical protein TREMEDRAFT_33299 similar to hypothetical protein CNBN0710 TREMEDRAFT_45155 similar to hypothetical protein CNBN0460 TREMEDRAFT_33230 similar to hypothetical protein CNBN0220 TREMEDRAFT_64216 similar to hypothetical protein CNBN0230 TREMEDRAFT_45156 similar to ER to Golgi transport-related protein, putative TREMEDRAFT_64218 predicted protein TREMEDRAFT_64220 predicted protein TREMEDRAFT_64222 predicted protein TREMEDRAFT_64224 predicted protein TREMEDRAFT_64225 predicted protein TREMEDRAFT_64226 similar to conserved hypothetical protein TREMEDRAFT_64227 similar to hypothetical protein CC1G_09716 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64228 similar to hypothetical protein CNBN0830 TREMEDRAFT_64229 predicted protein TREMEDRAFT_33534 similar to carbohydrate deacetylase TREMEDRAFT_14084 similar to pseudouridylate synthase, putative TREMEDRAFT_33282 similar to hypothetical protein CNBN1400 TREMEDRAFT_64235 predicted protein TREMEDRAFT_57498 similar to hypothetical protein CNN01290 TREMEDRAFT_33548 similar to hypothetical protein CNBN0630 TREMEDRAFT_74470 expressed protein TREMEDRAFT_64242 similar to glycoprotein gp2 TREMEDRAFT_64244 similar to riboflavin aldehyde-forming enzyme TREMEDRAFT_64245 similar to riboflavin aldehyde-forming enzyme TREMEDRAFT_64246 similar to expansin family protein TREMEDRAFT_33345 similar to hypothetical protein CNBN0740 TREMEDRAFT_64249 predicted protein TREMEDRAFT_33247 similar to MDM10, putative TREMEDRAFT_74472 predicted protein TREMEDRAFT_33495 similar to predicted protein TREMEDRAFT_64254 similar to hypothetical protein CNBN1390 TREMEDRAFT_64257 predicted protein TREMEDRAFT_64258 predicted protein TREMEDRAFT_23159 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64260 similar to transcription initiation factor IID (TFIID) subunit A-like protein TREMEDRAFT_64262 similar to hypothetical protein CC1G_01657 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_40321 similar to hypothetical protein CNBN1450 TREMEDRAFT_18062 similar to hypothetical protein CNBD1960; RPA32 TREMEDRAFT_64265 similar to hypothetical protein CNN01440 TREMEDRAFT_14561 similar to hypothetical protein CND04420 TREMEDRAFT_23958 similar to hypothetical protein CNBD1910 TREMEDRAFT_64268 similar to hypothetical protein CNBD1920 TREMEDRAFT_33206 similar to hypothetical protein CNBN1310 TREMEDRAFT_64270 similar to predicted protein TREMEDRAFT_33280 similar to predicted protein TREMEDRAFT_33305 similar to hypothetical protein BC1G_11233 TREMEDRAFT_74479 predicted protein TREMEDRAFT_64275 predicted protein TREMEDRAFT_64276 similar to hypothetical protein CNBD2000 TREMEDRAFT_33515 similar to hypothetical protein CNBD1980 TREMEDRAFT_64279 similar to hypothetical protein CNBD2060 TREMEDRAFT_33454 similar to hypothetical protein CNBD2070 TREMEDRAFT_64282 similar to hypothetical protein CNBD2090 TREMEDRAFT_64283 similar to hypothetical protein TREMEDRAFT_33323 similar to conserved hypothetical protein TREMEDRAFT_64285 predicted protein TREMEDRAFT_64286 predicted protein TREMEDRAFT_69678 similar to hypothetical protein CNBD2150 TREMEDRAFT_72160 similar to hypothetical protein CNBD2140 TREMEDRAFT_12429 similar to hypothetical protein CNBD2160 TREMEDRAFT_64292 similar to hypothetical protein CNBF1090 TREMEDRAFT_64293 similar to hypothetical protein CNBD2130 TREMEDRAFT_69682 similar to hypothetical protein CNBN1680 TREMEDRAFT_33187 similar to hypothetical protein CNBN1710 TREMEDRAFT_33227 similar to hypothetical protein CNBN1720 TREMEDRAFT_69686 similar to hypothetical protein CNB03760 TREMEDRAFT_21535 similar to hypothetical protein CNBN1740 TREMEDRAFT_33353 similar to hypothetical protein CNBN1760 TREMEDRAFT_33545 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64303 predicted protein TREMEDRAFT_64304 similar to hypothetical protein TREMEDRAFT_33328 predicted protein TREMEDRAFT_64306 predicted protein TREMEDRAFT_64307 predicted protein TREMEDRAFT_40350 similar to hypothetical protein CNBN1830 TREMEDRAFT_11732 similar to hypothetical protein CNBN2150 TREMEDRAFT_74492 similar to hypothetical protein CNBN2140 TREMEDRAFT_64316 predicted protein TREMEDRAFT_74496 similar to DNA dependent ATPase, putative TREMEDRAFT_45215 similar to hypothetical protein CNBN1590 TREMEDRAFT_33284 similar to hypothetical protein CNBN1580 TREMEDRAFT_33370 similar to hypothetical protein CNBN1570 TREMEDRAFT_33442 similar to hypothetical protein CNBN1560 TREMEDRAFT_33322 similar to hypothetical protein CNBN1540 TREMEDRAFT_33208 similar to predicted protein TREMEDRAFT_64326 similar to C-x8-C-x5-C-x3-H type zinc finger protein TREMEDRAFT_74502 similar to hypothetical protein CNN01510 TREMEDRAFT_64328 expressed protein TREMEDRAFT_33358 similar to predicted protein TREMEDRAFT_33393 similar to Probable O-acetyltransferase CAS1 (Capsule synthesis protein 1) TREMEDRAFT_64331 similar to hypothetical protein CNBN1500 TREMEDRAFT_64332 similar to hypothetical protein CNBN1500 TREMEDRAFT_45223 similar to hypothetical protein CNBD0770 TREMEDRAFT_64335 predicted protein TREMEDRAFT_64336 predicted protein TREMEDRAFT_64337 predicted protein TREMEDRAFT_64338 predicted protein TREMEDRAFT_40373 similar to hypothetical protein CNBN0210 TREMEDRAFT_20130 similar to Yeast Matalpha2MCM1DNA TERNARY TRANSCRIPTION COMPLEX Crystal Structure TREMEDRAFT_64341 similar to protein-nucleus import-related protein, putative TREMEDRAFT_33259 similar to Glycylpeptide N-tetradecanoyltransferase (Peptide N-myristoyltransferase) (Myristoyl-CoA:protein N-myristoyltransferase) (NMT) TREMEDRAFT_64343 similar to hypothetical protein TREMEDRAFT_64344 predicted protein TREMEDRAFT_64345 predicted protein TREMEDRAFT_64346 predicted protein TREMEDRAFT_64347 predicted protein TREMEDRAFT_64348 predicted protein TREMEDRAFT_64349 predicted protein TREMEDRAFT_64350 predicted protein TREMEDRAFT_33498 similar to hypothetical protein CNBN0140 TREMEDRAFT_40374 similar to ribosomal protein, putative TREMEDRAFT_64353 predicted protein TREMEDRAFT_64355 predicted protein TREMEDRAFT_64357 similar to hypothetical protein CNJ03000 TREMEDRAFT_33268 similar to hypothetical protein CNN00560 TREMEDRAFT_33438 similar to hypothetical protein An12g05080 TREMEDRAFT_17420 similar to hypothetical protein CNBA8170 TREMEDRAFT_64361 predicted protein TREMEDRAFT_64362 predicted protein TREMEDRAFT_64363 predicted protein TREMEDRAFT_74507 similar to hypothetical protein CNBN0150 TREMEDRAFT_64365 similar to hypothetical protein CNI02910 TREMEDRAFT_72180 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_40383 similar to DNA-binding protein cre-1, putative; expressed hypothetical protein TREMEDRAFT_64368 predicted protein TREMEDRAFT_33569 similar to hypothetical protein CNBN0160 TREMEDRAFT_64370 similar to hypothetical protein 26.t00109 TREMEDRAFT_64372 predicted protein TREMEDRAFT_64373 predicted protein TREMEDRAFT_74510 predicted protein TREMEDRAFT_72182 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_64377 predicted protein TREMEDRAFT_64378 predicted protein TREMEDRAFT_64380 similar to paternally expressed 10 TREMEDRAFT_64381 predicted protein TREMEDRAFT_64384 predicted protein TREMEDRAFT_64386 similar to hypothetical protein CIMG_04839 TREMEDRAFT_64388 predicted protein TREMEDRAFT_64389 predicted protein TREMEDRAFT_64391 similar to hypothetical protein CNM00430 TREMEDRAFT_69718 similar to hypothetical protein FG08255.1 TREMEDRAFT_64396 similar to unnamed protein product TREMEDRAFT_33836 similar to putative prolyl aminopeptidase TREMEDRAFT_64398 similar to AER291Cp TREMEDRAFT_33907 similar to hypothetical protein An12g05090 TREMEDRAFT_45240 similar to hypothetical protein CC1G_06972 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64402 similar to HpcH/HpaI aldolase TREMEDRAFT_64403 similar to hypothetical protein CIMG_10017 TREMEDRAFT_57534 expressed protein TREMEDRAFT_64406 similar to hypothetical protein TREMEDRAFT_33698 similar to hypothetical protein CNBD3520 TREMEDRAFT_64408 predicted protein TREMEDRAFT_64410 similar to hypothetical protein CNBI1040 TREMEDRAFT_64411 predicted protein TREMEDRAFT_33972 similar to hypothetical protein CNBI1260 TREMEDRAFT_64413 similar to hypothetical protein CND04740 TREMEDRAFT_22618 similar to glycoside hydrolase family 5 protein TREMEDRAFT_69728 similar to hypothetical protein CNBH1020 TREMEDRAFT_64415 predicted protein TREMEDRAFT_64416 predicted protein TREMEDRAFT_33755 similar to hypothetical protein CNBI1250 TREMEDRAFT_64418 predicted protein TREMEDRAFT_64420 predicted protein TREMEDRAFT_64422 similar to vacuolar amino acid permease TREMEDRAFT_64423 predicted protein TREMEDRAFT_64424 predicted protein TREMEDRAFT_64425 predicted protein TREMEDRAFT_33687 similar to hypothetical protein CNBI0560 TREMEDRAFT_64428 predicted protein TREMEDRAFT_64429 predicted protein TREMEDRAFT_64430 predicted protein TREMEDRAFT_64431 similar to hypothetical protein CNBI1100 TREMEDRAFT_64432 predicted protein TREMEDRAFT_64433 predicted protein TREMEDRAFT_64434 predicted protein TREMEDRAFT_72189 similar to 4-aminobutyrate aminotransferase, putative; expressed hypothetical protein TREMEDRAFT_64436 predicted protein TREMEDRAFT_64437 predicted protein TREMEDRAFT_64441 predicted protein TREMEDRAFT_64442 predicted protein TREMEDRAFT_64444 similar to putative reverse transcriptase TREMEDRAFT_64445 predicted protein TREMEDRAFT_64446 similar to proteophosphoglycan TREMEDRAFT_64447 predicted protein TREMEDRAFT_64448 similar to hypothetical protein CNB00460 TREMEDRAFT_69735 similar to hypothetical protein CNBF1830 TREMEDRAFT_24075 similar to Uncharacterized protein B0310.4 TREMEDRAFT_64451 predicted protein TREMEDRAFT_33656 similar to hypothetical protein CNBF1830 TREMEDRAFT_64453 predicted protein TREMEDRAFT_64454 predicted protein TREMEDRAFT_64455 predicted protein TREMEDRAFT_69737 similar to 3-beta hydroxysteroid dehydrogenase/isomerase TREMEDRAFT_33866 similar to unnamed protein product TREMEDRAFT_64459 predicted protein TREMEDRAFT_64460 predicted protein TREMEDRAFT_64461 similar to proline rich protein TREMEDRAFT_64463 similar to hypothetical protein CC1G_11052 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64464 predicted protein TREMEDRAFT_64465 predicted protein TREMEDRAFT_64467 predicted protein TREMEDRAFT_64468 predicted protein TREMEDRAFT_64469 similar to hypothetical protein CNC07050 TREMEDRAFT_64470 predicted protein TREMEDRAFT_64471 predicted protein TREMEDRAFT_69739 similar to hypothetical protein CNBC0150 TREMEDRAFT_64473 predicted protein TREMEDRAFT_64474 similar to GA10635-PA TREMEDRAFT_64477 predicted protein TREMEDRAFT_64478 predicted protein TREMEDRAFT_64480 predicted protein TREMEDRAFT_64482 predicted protein TREMEDRAFT_64483 predicted protein TREMEDRAFT_64484 predicted protein TREMEDRAFT_69740 similar to G protein gamma subunit Gpg1 TREMEDRAFT_74521 similar to pof4 protein, putative TREMEDRAFT_64486 predicted protein TREMEDRAFT_33737 similar to hypothetical protein CNBL0630 TREMEDRAFT_64488 similar to hypothetical protein TREMEDRAFT_64490 predicted protein TREMEDRAFT_64491 predicted protein TREMEDRAFT_64494 predicted protein TREMEDRAFT_64495 predicted protein TREMEDRAFT_64496 similar to hypothetical protein TREMEDRAFT_64497 predicted protein TREMEDRAFT_74522 similar to conserved hypothetical protein TREMEDRAFT_69743 similar to hypothetical protein CNBM0370 TREMEDRAFT_64500 predicted protein TREMEDRAFT_33779 similar to hypothetical protein CNBE3350 TREMEDRAFT_12207 similar to hypothetical protein CNE03200 TREMEDRAFT_33680 similar to hypothetical protein CNBE3240 TREMEDRAFT_33758 similar to hypothetical protein CNE03470 TREMEDRAFT_33730 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_64507 similar to hypothetical protein CNBE3450 TREMEDRAFT_33606 similar to hypothetical protein CNBE3430 TREMEDRAFT_33638 similar to hypothetical protein CNBE3490 TREMEDRAFT_64510 predicted protein TREMEDRAFT_33675 similar to terbinafine resistance locus protein (yip1) [Leishmania braziliensis MHOM/BR/75/M2904] TREMEDRAFT_74529 expressed protein TREMEDRAFT_72198 similar to nucleus protein, putative TREMEDRAFT_33743 similar to hypothetical protein CNBE3520 TREMEDRAFT_72199 similar to hypothetical protein CNBE3540 TREMEDRAFT_33615 similar to hypothetical protein CNBE3730 TREMEDRAFT_69764 similar to hypothetical protein CNBA1860 TREMEDRAFT_74535 similar to hypothetical protein CNBE4030 TREMEDRAFT_33998 similar to hypothetical protein CNBE3890 TREMEDRAFT_64525 similar to hypothetical protein CNBE3900 TREMEDRAFT_69766 similar to hypothetical protein CNBE4010 TREMEDRAFT_64527 similar to hypothetical protein CNE04010 TREMEDRAFT_64529 similar to hypothetical protein CNBE3980 TREMEDRAFT_64532 similar to hypothetical protein CNE03750 TREMEDRAFT_33735 similar to hypothetical protein CNBE3570 TREMEDRAFT_45287 similar to hypothetical protein CNBE3580 TREMEDRAFT_33832 similar to predicted protein TREMEDRAFT_64535 similar to unnamed protein product TREMEDRAFT_57559 expressed protein TREMEDRAFT_69771 similar to hypothetical protein CNBL2990 TREMEDRAFT_33875 similar to hypothetical protein CNBE3700 TREMEDRAFT_12962 similar to hypothetical protein CNBE3660 TREMEDRAFT_33731 similar to hypothetical protein CNBE3650 TREMEDRAFT_64542 similar to hypothetical protein CNBE3720 TREMEDRAFT_33896 similar to hypothetical protein CNBE4310 TREMEDRAFT_64544 similar to hypothetical protein UM00348.1 TREMEDRAFT_33831 similar to hypothetical protein CNBE4070 TREMEDRAFT_34025 similar to hypothetical protein CNBE3780 TREMEDRAFT_64548 similar to hypothetical protein CNBE3790 TREMEDRAFT_69780 similar to hypothetical protein CNBE3760 TREMEDRAFT_72212 similar to mitochondrial intermembrane space protein Mia40; expressed hypothetical protein TREMEDRAFT_33600 similar to protein-vacuolar targeting-related protein, putative TREMEDRAFT_64552 similar to predicted protein TREMEDRAFT_64553 predicted protein TREMEDRAFT_64554 predicted protein TREMEDRAFT_64555 predicted protein TREMEDRAFT_64557 similar to gag TREMEDRAFT_64558 predicted protein TREMEDRAFT_64560 predicted protein TREMEDRAFT_64561 predicted protein TREMEDRAFT_64563 predicted protein TREMEDRAFT_64564 predicted protein TREMEDRAFT_64565 predicted protein TREMEDRAFT_64568 predicted protein TREMEDRAFT_64569 predicted protein TREMEDRAFT_64572 predicted protein TREMEDRAFT_64573 predicted protein TREMEDRAFT_33878 similar to hypothetical protein CNBE3800 TREMEDRAFT_64576 predicted protein TREMEDRAFT_69786 similar to hypothetical protein CNBE4510 TREMEDRAFT_45306 similar to conserved hypothetical protein TREMEDRAFT_64580 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_69793 similar to hypothetical protein TREMEDRAFT_57567 expressed protein TREMEDRAFT_72219 similar to Protein EFR3 TREMEDRAFT_33900 similar to G-protein alpha subunit Gpa3 TREMEDRAFT_64587 predicted protein TREMEDRAFT_57570 similar to unnamed protein product; expressed hypothetical protein TREMEDRAFT_45320 similar to conserved hypothetical protein TREMEDRAFT_64590 similar to hypothetical protein CNBE4350 TREMEDRAFT_69802 similar to hypothetical protein CNBE4110 TREMEDRAFT_33685 similar to hypothetical protein CNBE4130 TREMEDRAFT_33885 similar to hypothetical protein CNE04340 TREMEDRAFT_19812 similar to predicted protein TREMEDRAFT_64599 similar to hypothetical protein CNE04910 TREMEDRAFT_33729 similar to hypothetical protein CNBE4810 TREMEDRAFT_33807 similar to integral to membrane protein, putative; expressed hypothetical protein TREMEDRAFT_69805 similar to conserved hypothetical protein TREMEDRAFT_40493 similar to hypothetical protein CNBE4500 TREMEDRAFT_33665 similar to allantoin transport; expressed hypothetical protein TREMEDRAFT_64605 predicted protein TREMEDRAFT_64606 predicted protein TREMEDRAFT_64608 predicted protein TREMEDRAFT_64614 predicted protein TREMEDRAFT_64615 similar to helicase, putative TREMEDRAFT_69815 similar to hypothetical protein CNBE4640 TREMEDRAFT_69817 similar to hypothetical protein CNBE4630 TREMEDRAFT_33648 similar to hypothetical protein CNBE4980 TREMEDRAFT_64621 similar to hypothetical protein CNBE5030 TREMEDRAFT_40507 similar to cyclin-dependent protein kinase regulator, putative; expressed hypothetical protein TREMEDRAFT_33971 similar to hypothetical protein CNBE4380 TREMEDRAFT_16146 similar to hypothetical protein CNBE4390 TREMEDRAFT_13152 similar to GTPase activating protein, putative TREMEDRAFT_40511 similar to fatty acid synthase beta subunit TREMEDRAFT_64628 similar to hypothetical protein SKA58_10959 TREMEDRAFT_64629 predicted protein TREMEDRAFT_64630 similar to predicted protein TREMEDRAFT_40518 similar to nucleosome assembly protein I, putative; expressed hypothetical protein TREMEDRAFT_33693 similar to hypothetical protein CNBE4420 TREMEDRAFT_64633 similar to hypothetical protein CNE04230 TREMEDRAFT_33679 similar to hypothetical protein CNBE4090 TREMEDRAFT_33681 similar to predicted protein TREMEDRAFT_69827 similar to hypothetical protein CNBE4080 TREMEDRAFT_33591 Putative cryptochrome DASH TREMEDRAFT_33975 similar to hypothetical protein CNBE4190 TREMEDRAFT_64642 similar to hypothetical protein TREMEDRAFT_64643 similar to hypothetical protein CNC00250 TREMEDRAFT_33704 similar to conserved hypothetical protein TREMEDRAFT_34017 similar to phytoene dehydrogenase TREMEDRAFT_64646 predicted protein TREMEDRAFT_64647 predicted protein TREMEDRAFT_64648 predicted protein TREMEDRAFT_33717 similar to hypothetical protein CNBC6990 TREMEDRAFT_72237 expressed protein TREMEDRAFT_11606 similar to conserved hypothetical protein TREMEDRAFT_64654 predicted protein TREMEDRAFT_64655 predicted protein TREMEDRAFT_64658 predicted protein TREMEDRAFT_64661 predicted protein TREMEDRAFT_64662 predicted protein TREMEDRAFT_64663 predicted protein TREMEDRAFT_64664 predicted protein TREMEDRAFT_64665 predicted protein TREMEDRAFT_64666 similar to pleiomorphic adenoma gene-like 1, isoform CRA_b TREMEDRAFT_64667 predicted protein TREMEDRAFT_64668 similar to hypothetical protein CNBE4600 TREMEDRAFT_64669 predicted protein TREMEDRAFT_64670 expressed protein TREMEDRAFT_57593 expressed protein TREMEDRAFT_33920 similar to hypothetical protein CNBE4650 TREMEDRAFT_33759 similar to hypothetical protein CNBN1800 TREMEDRAFT_45369 similar to hypothetical protein CNBE3820 TREMEDRAFT_69844 similar to hypothetical protein CNBE3810 TREMEDRAFT_64678 predicted protein TREMEDRAFT_64679 predicted protein TREMEDRAFT_64680 predicted protein TREMEDRAFT_33616 similar to hypothetical protein CNE05060 TREMEDRAFT_64682 predicted protein TREMEDRAFT_69847 similar to hypothetical protein TREMEDRAFT_33924 similar to conserved hypothetical protein TREMEDRAFT_11883 similar to hypothetical protein CC1G_01933 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64687 similar to hypothetical protein CNBI2450 TREMEDRAFT_74579 similar to hypothetical protein CNBE5100 TREMEDRAFT_64689 similar to hypothetical protein TREMEDRAFT_74581 similar to RNA lariat debranching enzyme, putative; expressed hypothetical protein TREMEDRAFT_64692 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64694 predicted protein TREMEDRAFT_74583 similar to hypothetical protein CNBE5090 TREMEDRAFT_45381 similar to beta-1,4-mannosyltransferase, putative; expressed hypothetical protein TREMEDRAFT_74585 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_72250 similar to cytoplasm protein, putative TREMEDRAFT_17176 similar to hypothetical protein CNBE4610 TREMEDRAFT_40551 similar to mitochondrial processing peptidase, putative TREMEDRAFT_57606 expressed protein TREMEDRAFT_57607 expressed protein TREMEDRAFT_69861 similar to hypothetical protein CNBE4760 TREMEDRAFT_64705 predicted protein TREMEDRAFT_33777 similar to hypothetical protein CNE04540 TREMEDRAFT_33604 similar to hydrolase, putative TREMEDRAFT_64707 similar to hypothetical protein CNBE4590 TREMEDRAFT_64710 similar to hypothetical protein CNBE4890 TREMEDRAFT_33690 similar to hypothetical protein CNBE4770 TREMEDRAFT_33897 similar to proline dehydrogenase, putative TREMEDRAFT_74590 similar to hypothetical protein AN3352.2; expressed hypothetical protein TREMEDRAFT_64714 predicted protein TREMEDRAFT_64716 similar to hypothetical protein CNBC6030 TREMEDRAFT_64717 similar to gastric mucin TREMEDRAFT_64718 similar to hypothetical protein CNBF1570 TREMEDRAFT_34108 similar to hypothetical protein CNF03220 TREMEDRAFT_69868 similar to hypothetical protein CNBF1550 TREMEDRAFT_69871 similar to hypothetical protein CNBF1510 TREMEDRAFT_64724 predicted protein TREMEDRAFT_40560 similar to hypothetical protein CNBF1470 TREMEDRAFT_34153 similar to hypothetical protein CNBF1190 TREMEDRAFT_34173 similar to hypothetical protein CNBF1250 TREMEDRAFT_69876 similar to hypothetical protein CNBF1300 TREMEDRAFT_69877 similar to hypothetical protein AN2469.2 TREMEDRAFT_34208 similar to hypothetical protein MGL_3898 TREMEDRAFT_34182 similar to diphthine synthase, putative TREMEDRAFT_69881 predicted protein TREMEDRAFT_64734 predicted protein TREMEDRAFT_57613 predicted protein TREMEDRAFT_64738 similar to hypothetical protein CNBB0010 TREMEDRAFT_64739 similar to hypothetical protein CNB00460 TREMEDRAFT_34446 similar to hypothetical protein CNBF1700 TREMEDRAFT_45408 similar to GPI inositol-deacylase; expressed hypothetical protein TREMEDRAFT_69890 similar to hypothetical protein CNBF1730 TREMEDRAFT_34104 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_40588 similar to late endosome to vacuole transport-related protein, putative TREMEDRAFT_64749 similar to conserved hypothetical protein TREMEDRAFT_34129 similar to enzyme activator TREMEDRAFT_64752 similar to aflatoxin efflux pump AFLT, putative TREMEDRAFT_64753 similar to pathogenesis-related protein TREMEDRAFT_64754 similar to predicted protein TREMEDRAFT_34164 similar to phospholipase, putative TREMEDRAFT_64756 similar to hypothetical protein CNBA5570 TREMEDRAFT_69901 similar to hypothetical protein CNBF1420 TREMEDRAFT_69902 similar to thread matrix protein 1A; expressed hypothetical protein TREMEDRAFT_34308 similar to hypothetical protein CNBN1780 TREMEDRAFT_64761 similar to hypothetical protein CNF04200 TREMEDRAFT_34431 similar to hypothetical protein CNBF1030 TREMEDRAFT_69905 similar to hypothetical protein CNF03820 TREMEDRAFT_64766 predicted protein TREMEDRAFT_64768 similar to hypothetical protein CNBF1090 TREMEDRAFT_64769 similar to hypothetical protein CNBF1090 TREMEDRAFT_64770 predicted protein TREMEDRAFT_40602 similar to phosphatidylinositol 3-kinase TOR1 TREMEDRAFT_74612 similar to hypothetical protein CNBF1070 TREMEDRAFT_64773 predicted protein TREMEDRAFT_64774 predicted protein TREMEDRAFT_64776 predicted protein TREMEDRAFT_64777 predicted protein TREMEDRAFT_64778 predicted protein TREMEDRAFT_64779 predicted protein TREMEDRAFT_45442 similar to hypothetical protein CNBF1060 TREMEDRAFT_64782 predicted protein TREMEDRAFT_64783 predicted protein TREMEDRAFT_64784 similar to conserved hypothetical protein TREMEDRAFT_69910 similar to hypothetical protein CNBF0800 TREMEDRAFT_64787 predicted protein TREMEDRAFT_64789 similar to hypothetical protein CNBF1210 TREMEDRAFT_34209 similar to hypothetical protein CNBF0810 TREMEDRAFT_64792 predicted protein TREMEDRAFT_64793 predicted protein TREMEDRAFT_64794 predicted protein TREMEDRAFT_64796 similar to hypothetical protein CIMG_04839 TREMEDRAFT_64799 predicted protein TREMEDRAFT_64800 predicted protein TREMEDRAFT_57627 expressed protein TREMEDRAFT_64803 predicted protein TREMEDRAFT_64804 predicted protein TREMEDRAFT_34131 similar to hypothetical protein CNBF0940 TREMEDRAFT_69918 similar to conserved hypothetical protein TREMEDRAFT_64808 predicted protein TREMEDRAFT_64809 predicted protein TREMEDRAFT_64810 predicted protein TREMEDRAFT_64811 predicted protein TREMEDRAFT_64812 predicted protein TREMEDRAFT_64813 predicted protein TREMEDRAFT_64814 similar to hypothetical protein CNE02140 TREMEDRAFT_34176 similar to hypothetical protein CNBF0980 TREMEDRAFT_64817 predicted protein TREMEDRAFT_74619 similar to hypothetical protein CNBF0910 TREMEDRAFT_34237 similar to hypothetical protein CNN01850 TREMEDRAFT_64821 predicted protein TREMEDRAFT_64822 predicted protein TREMEDRAFT_64823 predicted protein TREMEDRAFT_64824 predicted protein TREMEDRAFT_64825 predicted protein TREMEDRAFT_64826 predicted protein TREMEDRAFT_64830 predicted protein TREMEDRAFT_64831 predicted protein TREMEDRAFT_64832 similar to hypothetical protein, partial TREMEDRAFT_64833 similar to hypothetical protein CNBN2270 TREMEDRAFT_69926 expressed protein TREMEDRAFT_34336 similar to hypothetical protein CNBF0930 TREMEDRAFT_34338 similar to hypothetical protein CNBF0960 TREMEDRAFT_64837 predicted protein TREMEDRAFT_64838 predicted protein TREMEDRAFT_64840 similar to hypothetical protein CIMG_04839 TREMEDRAFT_64841 predicted protein TREMEDRAFT_64842 predicted protein TREMEDRAFT_64843 predicted protein TREMEDRAFT_40623 similar to hypothetical protein CNF01760 TREMEDRAFT_64848 predicted protein TREMEDRAFT_64849 predicted protein TREMEDRAFT_64850 predicted protein TREMEDRAFT_64852 similar to hypothetical protein CIMG_04839 TREMEDRAFT_64854 predicted protein TREMEDRAFT_64855 predicted protein TREMEDRAFT_64856 predicted protein TREMEDRAFT_64858 predicted protein TREMEDRAFT_64860 predicted protein TREMEDRAFT_34340 similar to arginine metabolism transcriptional control protein, putative TREMEDRAFT_64862 similar to hypothetical protein CNBI1750 TREMEDRAFT_64863 similar to hypothetical protein CC1G_07935 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_64864 predicted protein TREMEDRAFT_34326 similar to hypothetical protein CNBN2350 TREMEDRAFT_74630 similar to mitochondrial ornithine transporter 1, putative; expressed hypothetical protein TREMEDRAFT_64868 predicted protein TREMEDRAFT_64869 predicted protein TREMEDRAFT_64870 predicted protein TREMEDRAFT_64871 predicted protein TREMEDRAFT_64873 similar to gag TREMEDRAFT_64874 predicted protein TREMEDRAFT_45474 similar to hypothetical protein CNBN2380 TREMEDRAFT_34384 similar to hypothetical protein TREMEDRAFT_64877 similar to conserved hypothetical protein TREMEDRAFT_64878 similar to hypothetical protein CNBF1800 TREMEDRAFT_64879 predicted protein TREMEDRAFT_15245 similar to hypothetical protein CNF03460 TREMEDRAFT_34084 similar to hypothetical protein CNBF1960 TREMEDRAFT_64882 similar to hypothetical protein CNBF1840 TREMEDRAFT_34232 similar to hypothetical protein CNBF0410 TREMEDRAFT_72293 similar to reduced potassium dependency 3 Rpd3p TREMEDRAFT_69942 similar to conserved hypothetical protein TREMEDRAFT_69944 similar to hypothetical protein CNBF1980 TREMEDRAFT_64889 predicted protein TREMEDRAFT_64890 similar to hypothetical protein CNBF1940 TREMEDRAFT_57639 expressed protein TREMEDRAFT_15754 similar to hypothetical protein SS1G_00475 TREMEDRAFT_64894 predicted protein TREMEDRAFT_64895 predicted protein TREMEDRAFT_34314 similar to unnamed protein product TREMEDRAFT_64897 predicted protein TREMEDRAFT_34219 similar to glucosamine 6-phosphate N-acetyltransferase, putative TREMEDRAFT_64900 similar to predicted protein TREMEDRAFT_34170 similar to hypothetical protein CNBA0390 TREMEDRAFT_34294 similar to hypothetical protein CNBF2060 TREMEDRAFT_64903 predicted protein TREMEDRAFT_69951 similar to Rho GTPase activator, putative TREMEDRAFT_34426 similar to negative regulation of transcription by glucose-related protein, putative TREMEDRAFT_64906 similar to conserved hypothetical protein TREMEDRAFT_69953 similar to unnamed protein product TREMEDRAFT_64908 predicted protein TREMEDRAFT_19213 similar to Transcription initiation factor TFIID subunit 10 (Transcription initiation factor TFIID 30 kDa subunit) (TAF(II)30) (TAFII-30) (TAFII30) (STAF28) TREMEDRAFT_45481 similar to hypothetical protein CNBK0430 TREMEDRAFT_45482 similar to CCAAT- binding transcription factor component; expressed hypothetical protein TREMEDRAFT_34172 similar to aromatic-amino-acid transaminase, putative; expressed hypothetical protein TREMEDRAFT_64913 predicted protein TREMEDRAFT_64915 predicted protein TREMEDRAFT_64917 predicted protein TREMEDRAFT_64918 predicted protein TREMEDRAFT_64920 predicted protein TREMEDRAFT_34408 similar to Protein RAI1 TREMEDRAFT_34263 similar to sterol O-acyltransferase, putative TREMEDRAFT_23521 similar to predicted protein TREMEDRAFT_34086 similar to hypothetical protein CNBF3050 TREMEDRAFT_45490 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_34261 similar to glycoside hydrolase family 16 protein TREMEDRAFT_64928 predicted protein TREMEDRAFT_64930 predicted protein TREMEDRAFT_64931 predicted protein TREMEDRAFT_64932 predicted protein TREMEDRAFT_69963 similar to hypothetical protein CNF01740 TREMEDRAFT_69964 similar to ER-to-Golgi vesicle protein transport Sft2 TREMEDRAFT_69965 similar to hypothetical protein CNBF3000 TREMEDRAFT_34428 similar to hypothetical protein CNBF2990 TREMEDRAFT_69967 similar to nuclear mRNA splicing protein TREMEDRAFT_34242 similar to hypothetical protein CNBF3020 TREMEDRAFT_34364 similar to predicted protein TREMEDRAFT_74637 similar to conserved hypothetical protein TREMEDRAFT_34158 similar to conserved hypothetical protein TREMEDRAFT_64943 predicted protein TREMEDRAFT_72299 expressed protein TREMEDRAFT_64944 similar to hypothetical protein CNBF2860 TREMEDRAFT_69974 similar to hypothetical protein CNBF2880 TREMEDRAFT_34367 similar to Glutathione S-transferase 6, putative TREMEDRAFT_64948 similar to hypothetical protein BC1G_12385 TREMEDRAFT_64949 predicted protein TREMEDRAFT_64950 similar to hypothetical protein CNF02240 TREMEDRAFT_64951 similar to predicted protein TREMEDRAFT_40662 similar to chitin deacetylase, putative; expressed hypothetical protein TREMEDRAFT_69977 similar to hypothetical protein CNF01870 TREMEDRAFT_40668 similar to hypothetical protein CNF01880 TREMEDRAFT_64957 similar to hypothetical protein TREMEDRAFT_64958 similar to Serine/threonine-protein kinase TEL1 (DNA-damage checkpoint kinase TEL1) (Telomere length regulation protein 1) (ATM homolog) TREMEDRAFT_64959 predicted protein TREMEDRAFT_34391 similar to predicted protein TREMEDRAFT_64962 predicted protein TREMEDRAFT_64963 predicted protein TREMEDRAFT_64964 predicted protein TREMEDRAFT_64965 predicted protein TREMEDRAFT_64966 similar to hypothetical protein CNBF2680 TREMEDRAFT_69984 similar to hypothetical protein CNBF2670 TREMEDRAFT_64968 predicted protein TREMEDRAFT_45509 similar to sulfur metabolite repression control protein, putative TREMEDRAFT_57648 predicted protein TREMEDRAFT_64973 predicted protein TREMEDRAFT_45515 similar to 30s ribosomal protein s5, putative; expressed hypothetical protein TREMEDRAFT_64976 predicted protein TREMEDRAFT_64977 similar to conserved hypothetical protein TREMEDRAFT_64978 predicted protein TREMEDRAFT_12670 similar to regulation of carbohydrate metabolism-related protein, putative TREMEDRAFT_64980 similar to hypothetical protein TREMEDRAFT_34120 similar to hypothetical protein CNF01900 TREMEDRAFT_64982 predicted protein TREMEDRAFT_74647 similar to hypothetical protein CNBF2790 TREMEDRAFT_64984 similar to hypothetical protein CNBF3690 TREMEDRAFT_64985 predicted protein TREMEDRAFT_64986 similar to hypothetical protein FG09410.1 TREMEDRAFT_34383 similar to cytoplasm protein, putative TREMEDRAFT_34074 similar to hypothetical protein CNF03540 TREMEDRAFT_64990 similar to hypothetical protein CNF03300 TREMEDRAFT_34323 similar to conserved hypothetical protein TREMEDRAFT_34372 similar to Beta-hexosaminidase precursor, putative TREMEDRAFT_64993 similar to predicted protein TREMEDRAFT_15877 similar to hypothetical protein CNBF1160 TREMEDRAFT_64996 similar to hypothetical protein CNF03590 TREMEDRAFT_45531 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_69995 similar to hypothetical protein CNBF1140 TREMEDRAFT_65001 predicted protein TREMEDRAFT_65002 predicted protein TREMEDRAFT_65003 predicted protein TREMEDRAFT_65004 predicted protein TREMEDRAFT_65006 predicted protein TREMEDRAFT_65007 similar to hypothetical protein CNBF1900 TREMEDRAFT_65008 similar to hypothetical protein CNBF1900 TREMEDRAFT_34063 similar to hypothetical protein CNBF1130 TREMEDRAFT_65012 similar to hypothetical protein CNBF1150 TREMEDRAFT_40705 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_34070 similar to hypothetical protein CNBN2400 TREMEDRAFT_65015 similar to WSC domain protein TREMEDRAFT_65016 predicted protein TREMEDRAFT_40715 similar to hypothetical protein CNBN2430 TREMEDRAFT_65020 similar to hypothetical protein CNBA4380 TREMEDRAFT_65021 predicted protein TREMEDRAFT_65023 predicted protein TREMEDRAFT_65024 predicted protein TREMEDRAFT_65025 similar to hypothetical protein CNG00120 TREMEDRAFT_65026 predicted protein TREMEDRAFT_65027 predicted protein TREMEDRAFT_65028 similar to unnamed protein product TREMEDRAFT_65029 predicted protein TREMEDRAFT_65030 predicted protein TREMEDRAFT_65032 predicted protein TREMEDRAFT_65033 predicted protein TREMEDRAFT_65034 predicted protein TREMEDRAFT_65035 predicted protein TREMEDRAFT_70004 similar to hypothetical protein AN6238.2 TREMEDRAFT_65039 predicted protein TREMEDRAFT_65040 similar to hypothetical protein An09g06370 TREMEDRAFT_65041 similar to hypothetical protein TREMEDRAFT_65042 predicted protein TREMEDRAFT_65043 predicted protein TREMEDRAFT_65044 predicted protein TREMEDRAFT_65045 predicted protein TREMEDRAFT_72315 similar to hypothetical protein AN1596.2; expressed hypothetical protein TREMEDRAFT_65047 predicted protein TREMEDRAFT_34616 similar to hypothetical protein UM00103.1 TREMEDRAFT_34686 similar to SPO14 TREMEDRAFT_65050 predicted protein TREMEDRAFT_65055 predicted protein TREMEDRAFT_65057 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65059 predicted protein TREMEDRAFT_65060 predicted protein TREMEDRAFT_65063 predicted protein TREMEDRAFT_65064 predicted protein TREMEDRAFT_65065 predicted protein TREMEDRAFT_65066 predicted protein TREMEDRAFT_65068 predicted protein TREMEDRAFT_65069 predicted protein TREMEDRAFT_65071 predicted protein TREMEDRAFT_65072 predicted protein TREMEDRAFT_65073 predicted protein TREMEDRAFT_65074 predicted protein TREMEDRAFT_65075 similar to predicted protein TREMEDRAFT_34670 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_65077 predicted protein TREMEDRAFT_65078 predicted protein TREMEDRAFT_65079 predicted protein TREMEDRAFT_65080 predicted protein TREMEDRAFT_65081 predicted protein TREMEDRAFT_65082 predicted protein TREMEDRAFT_65084 predicted protein TREMEDRAFT_65085 predicted protein TREMEDRAFT_65087 predicted protein TREMEDRAFT_65088 predicted protein TREMEDRAFT_34467 similar to hypothetical protein CND02390 TREMEDRAFT_65090 predicted protein TREMEDRAFT_74665 similar to hypothetical protein CNBF1830 TREMEDRAFT_65092 predicted protein TREMEDRAFT_65093 predicted protein TREMEDRAFT_65094 predicted protein TREMEDRAFT_34561 similar to hypothetical protein CNBD0390 TREMEDRAFT_45563 similar to histone deacetylation-related protein, putative TREMEDRAFT_65099 predicted protein TREMEDRAFT_65100 predicted protein TREMEDRAFT_65101 predicted protein TREMEDRAFT_65102 predicted protein TREMEDRAFT_34691 similar to RPL22; expressed hypothetical protein TREMEDRAFT_57674 expressed protein TREMEDRAFT_57675 similar to sexual development regulator; expressed hypothetical protein TREMEDRAFT_65105 similar to SXI2 TREMEDRAFT_65106 predicted protein TREMEDRAFT_65107 predicted protein TREMEDRAFT_65108 predicted protein TREMEDRAFT_65109 similar to Lysine-rich arabinogalactan protein 19 precursor (Lys-rich AGP 19) TREMEDRAFT_65110 predicted protein TREMEDRAFT_65112 similar to hypothetical protein TREMEDRAFT_65113 predicted protein TREMEDRAFT_65115 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65116 predicted protein TREMEDRAFT_65117 predicted protein TREMEDRAFT_34488 similar to hypothetical protein CNBD4650 TREMEDRAFT_34482 similar to hypothetical protein SNOG_06882 TREMEDRAFT_65120 predicted protein TREMEDRAFT_65121 predicted protein TREMEDRAFT_65122 predicted protein TREMEDRAFT_65123 predicted protein TREMEDRAFT_65124 predicted protein TREMEDRAFT_65126 predicted protein TREMEDRAFT_65131 predicted protein TREMEDRAFT_65132 predicted protein TREMEDRAFT_65135 predicted protein TREMEDRAFT_65136 predicted protein TREMEDRAFT_65137 predicted protein TREMEDRAFT_65138 similar to hypothetical protein CNBD4640 TREMEDRAFT_34664 similar to predicted protein TREMEDRAFT_65139 predicted protein TREMEDRAFT_65141 similar to nuclear core glycoprotein; expressed hypothetical protein TREMEDRAFT_18685 similar to hypothetical protein CNBD3110 TREMEDRAFT_34512 similar to hypothetical protein CNBD3100 TREMEDRAFT_70024 similar to hypothetical protein CNBD3430 TREMEDRAFT_34464 similar to hypothetical protein CNBD3770 TREMEDRAFT_45583 similar to conserved hypothetical protein TREMEDRAFT_57681 expressed protein TREMEDRAFT_65148 predicted protein TREMEDRAFT_70028 similar to hypothetical protein CNBD3470 TREMEDRAFT_34640 similar to hypothetical protein CNBD3310 TREMEDRAFT_34518 similar to hypothetical protein CNBD3530 TREMEDRAFT_34696 similar to hypothetical protein CND03090 TREMEDRAFT_65156 predicted protein TREMEDRAFT_65157 similar to predicted protein TREMEDRAFT_65159 similar to hypothetical protein CHGG_04422 TREMEDRAFT_34550 similar to hypothetical protein CNBD3490 TREMEDRAFT_65162 similar to hypothetical protein TREMEDRAFT_45592 similar to hypothetical protein CNBD3500 TREMEDRAFT_40763 similar to hypothetical protein CNBD3300 TREMEDRAFT_65169 similar to hypothetical protein CNBB4710 TREMEDRAFT_74684 similar to Dullard protein; expressed hypothetical protein TREMEDRAFT_34604 similar to predicted protein TREMEDRAFT_70041 similar to CAP1-related TREMEDRAFT_65174 predicted protein TREMEDRAFT_65175 predicted protein TREMEDRAFT_65176 predicted protein TREMEDRAFT_34462 similar to 1-phosphatidylinositol-3-phosphate 5-kinase, putative TREMEDRAFT_40774 similar to high-affinity cell membrane calcium channel TREMEDRAFT_65179 predicted protein TREMEDRAFT_65180 predicted protein TREMEDRAFT_65181 predicted protein TREMEDRAFT_65184 predicted protein TREMEDRAFT_65185 similar to hypothetical protein CND03310 TREMEDRAFT_65186 predicted protein TREMEDRAFT_34565 similar to hypothetical protein CNBD3410 TREMEDRAFT_34491 similar to hypothetical protein CND02970 TREMEDRAFT_65191 predicted protein TREMEDRAFT_65193 predicted protein TREMEDRAFT_65194 predicted protein TREMEDRAFT_65195 similar to hypothetical protein CNBC6160 TREMEDRAFT_65196 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_65197 similar to hypothetical protein CNBC6150 TREMEDRAFT_45618 similar to Putative lipase ATG15 (Autophagy-related protein 15) TREMEDRAFT_65199 similar to hypothetical protein CNBC6240 TREMEDRAFT_70051 similar to hypothetical protein TREMEDRAFT_70052 similar to hypothetical protein CNC01300 TREMEDRAFT_65201 similar to hypothetical protein CNBC5920 TREMEDRAFT_34483 similar to hypothetical protein CC1G_07151 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_34583 similar to hypothetical protein CNBB2810 TREMEDRAFT_65205 predicted protein TREMEDRAFT_65207 similar to hypothetical protein CNBL2780 TREMEDRAFT_65208 predicted protein TREMEDRAFT_65211 predicted protein TREMEDRAFT_65212 predicted protein TREMEDRAFT_74694 similar to VelB; expressed hypothetical protein TREMEDRAFT_65215 predicted protein TREMEDRAFT_65216 predicted protein TREMEDRAFT_65217 predicted protein TREMEDRAFT_65218 predicted protein TREMEDRAFT_65219 predicted protein TREMEDRAFT_74695 similar to unknown protein; expressed hypothetical protein TREMEDRAFT_65221 similar to hypothetical protein CNC01340 TREMEDRAFT_34638 similar to polyamine transport-related protein, putative TREMEDRAFT_40794 similar to hypothetical protein CNBC6050 TREMEDRAFT_13664 similar to conserved hypothetical protein TREMEDRAFT_34698 similar to SNF1 family protein kinase, putative TREMEDRAFT_57702 expressed protein TREMEDRAFT_70063 similar to hypothetical protein CNBC6010 TREMEDRAFT_13254 similar to hypothetical protein CNBC6000 TREMEDRAFT_34460 similar to hypothetical protein CNBC5990 TREMEDRAFT_65226 predicted protein TREMEDRAFT_65227 predicted protein TREMEDRAFT_65228 predicted protein TREMEDRAFT_65229 predicted protein TREMEDRAFT_65231 similar to gag TREMEDRAFT_65232 predicted protein TREMEDRAFT_65234 predicted protein TREMEDRAFT_65235 predicted protein TREMEDRAFT_34613 similar to Hypothetical protein T05A7.9 TREMEDRAFT_65237 predicted protein TREMEDRAFT_65239 similar to hypothetical protein CC1G_08553 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_19209 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_65241 similar to hypothetical protein EhV247 TREMEDRAFT_65242 predicted protein TREMEDRAFT_65244 predicted protein TREMEDRAFT_65246 similar to gag TREMEDRAFT_14215 similar to conserved hypothetical protein TREMEDRAFT_65249 predicted protein TREMEDRAFT_34745 similar to predicted protein TREMEDRAFT_65251 predicted protein TREMEDRAFT_65252 predicted protein TREMEDRAFT_57704 expressed protein TREMEDRAFT_65254 predicted protein TREMEDRAFT_65255 predicted protein TREMEDRAFT_65257 predicted protein TREMEDRAFT_65258 predicted protein TREMEDRAFT_65259 predicted protein TREMEDRAFT_65260 similar to Myosin Ie (Myosin Ic), partial TREMEDRAFT_65261 predicted protein TREMEDRAFT_65262 predicted protein TREMEDRAFT_65263 predicted protein TREMEDRAFT_34614 similar to predicted protein TREMEDRAFT_65265 predicted protein TREMEDRAFT_65267 predicted protein TREMEDRAFT_65268 predicted protein TREMEDRAFT_65270 similar to hypothetical protein CNBF1830 TREMEDRAFT_65272 predicted protein TREMEDRAFT_65273 predicted protein TREMEDRAFT_65274 similar to hypothetical protein TREMEDRAFT_65275 predicted protein TREMEDRAFT_70067 similar to Rab guanyl-nucleotide exchange factor, putative; expressed hypothetical protein TREMEDRAFT_74701 similar to hypothetical protein CNBL0590 TREMEDRAFT_65278 similar to hypothetical protein DEHA0G07975g TREMEDRAFT_65279 predicted protein TREMEDRAFT_70068 similar to hypothetical protein CNBL0890 TREMEDRAFT_65281 predicted protein TREMEDRAFT_65282 similar to hypothetical protein CNBL0670 TREMEDRAFT_65283 similar to conserved hypothetical protein TREMEDRAFT_65285 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_65286 similar to RNA polymerase II transcription factor, putative TREMEDRAFT_70072 similar to hypothetical protein CNH00860 TREMEDRAFT_16292 similar to hypothetical protein CNH00850 TREMEDRAFT_65289 predicted protein TREMEDRAFT_65291 predicted protein TREMEDRAFT_65292 predicted protein TREMEDRAFT_65293 similar to hypothetical protein CNBF1830 TREMEDRAFT_65294 predicted protein TREMEDRAFT_65295 predicted protein TREMEDRAFT_34771 similar to rab domain-containing cell division control protein TREMEDRAFT_74703 similar to hypothetical protein CNBL0720 TREMEDRAFT_65298 predicted protein TREMEDRAFT_65299 similar to hCG1642748 TREMEDRAFT_65300 predicted protein TREMEDRAFT_65305 predicted protein TREMEDRAFT_65306 predicted protein TREMEDRAFT_65308 predicted protein TREMEDRAFT_65309 predicted protein TREMEDRAFT_65310 predicted protein TREMEDRAFT_74704 expressed protein TREMEDRAFT_34949 similar to hypothetical protein CNBL0700 TREMEDRAFT_70076 similar to hypothetical protein CNBL0660 TREMEDRAFT_34790 similar to Endoglucanase E-4 precursor, putative TREMEDRAFT_35021 similar to hypothetical protein CNH00950 TREMEDRAFT_34991 similar to pH-response transcription factor pacC/RIM101; expressed hypothetical protein TREMEDRAFT_65316 predicted protein TREMEDRAFT_65317 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65319 predicted protein TREMEDRAFT_65320 similar to zinc finger/thioredoxin putative TREMEDRAFT_65322 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65324 predicted protein TREMEDRAFT_70078 similar to transposase TREMEDRAFT_65328 predicted protein TREMEDRAFT_65329 predicted protein TREMEDRAFT_65330 similar to hypothetical protein CNBL0830 TREMEDRAFT_45638 similar to Pre-mRNA-processing protein 45 TREMEDRAFT_65332 predicted protein TREMEDRAFT_65333 predicted protein TREMEDRAFT_34801 similar to conserved hypothetical protein TREMEDRAFT_65335 predicted protein TREMEDRAFT_34797 similar to hypothetical protein CNH00820 TREMEDRAFT_70081 similar to Kex2 [Cryptococcus neoformans A/D] TREMEDRAFT_65338 similar to conserved hypothetical protein TREMEDRAFT_65341 similar to unnamed protein product TREMEDRAFT_34999 similar to hypothetical protein CNBB5260 TREMEDRAFT_70084 similar to hypothetical protein CNH00700 TREMEDRAFT_45640 similar to minor histocompatibility antigen h13, putative; expressed hypothetical protein TREMEDRAFT_65345 similar to predicted protein TREMEDRAFT_65347 similar to hypothetical protein CNH00390 TREMEDRAFT_65348 predicted protein TREMEDRAFT_65349 similar to hypothetical protein CNBL0300 TREMEDRAFT_65352 similar to hypothetical protein CNBL0330 TREMEDRAFT_65353 predicted protein TREMEDRAFT_65354 predicted protein TREMEDRAFT_65355 predicted protein TREMEDRAFT_65356 similar to hypothetical protein BC1G_04746 TREMEDRAFT_65357 predicted protein TREMEDRAFT_65359 similar to ATP-dependent RNA helicase MAK5 TREMEDRAFT_34878 similar to predicted protein TREMEDRAFT_45651 similar to cyclin-dependent kinase 5; expressed hypothetical protein TREMEDRAFT_65362 predicted protein TREMEDRAFT_34983 similar to predicted protein TREMEDRAFT_57719 expressed protein TREMEDRAFT_65366 predicted protein TREMEDRAFT_65367 predicted protein TREMEDRAFT_65372 predicted protein TREMEDRAFT_74716 similar to hypothetical protein CNBL2390 TREMEDRAFT_34775 similar to hypothetical protein CNBL2320 TREMEDRAFT_65375 predicted protein TREMEDRAFT_57721 expressed protein TREMEDRAFT_65377 predicted protein TREMEDRAFT_65378 similar to hypothetical protein CNBG2950 TREMEDRAFT_34926 similar to SD08430p, putative; expressed hypothetical protein TREMEDRAFT_34937 similar to hypothetical protein CNBL0170 TREMEDRAFT_34802 similar to hypothetical protein CNBL0500 TREMEDRAFT_40831 similar to hypothetical protein CNBL0340 TREMEDRAFT_65384 predicted protein TREMEDRAFT_12225 hypothetical protein TREMEDRAFT_65386 predicted protein TREMEDRAFT_72363 similar to specific RNA polymerase II transcription factor, putative TREMEDRAFT_72364 expressed protein TREMEDRAFT_70106 similar to hypothetical protein CNBB5260 TREMEDRAFT_70107 similar to hypothetical protein CNBL0560 TREMEDRAFT_40836 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_65394 predicted protein TREMEDRAFT_65395 similar to hypothetical protein CNBL0200 TREMEDRAFT_74725 similar to hypothetical protein CNBL0190 TREMEDRAFT_34882 similar to hypothetical protein CNH00410 TREMEDRAFT_65398 predicted protein TREMEDRAFT_34848 similar to hypothetical protein CNBL0400 TREMEDRAFT_65401 predicted protein TREMEDRAFT_65402 similar to hypothetical protein CC1G_01923 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_70113 similar to BET1 protein, putative TREMEDRAFT_34982 similar to hypothetical protein CNBC6490 TREMEDRAFT_65407 predicted protein TREMEDRAFT_70116 similar to hypothetical protein CNBC5670 TREMEDRAFT_34857 similar to hypothetical protein CNBC5740 TREMEDRAFT_65412 similar to hypothetical protein CNBC6310 TREMEDRAFT_35030 similar to hypothetical protein CNBC6320 TREMEDRAFT_57734 similar to Os03g0145200; expressed hypothetical protein TREMEDRAFT_72372 similar to hypothetical protein CNBC6460 TREMEDRAFT_65417 similar to beta-1,3-glucanase TREMEDRAFT_65418 similar to hypothetical protein CNBC6430 TREMEDRAFT_45682 similar to hypothetical protein CNBC6390 TREMEDRAFT_57739 expressed protein TREMEDRAFT_65422 predicted protein TREMEDRAFT_35002 similar to hypothetical protein CNBC5710 TREMEDRAFT_74736 similar to conserved hypothetical protein TREMEDRAFT_72376 expressed protein TREMEDRAFT_74739 similar to hypothetical protein AN9122.2; expressed hypothetical protein TREMEDRAFT_40864 similar to hypothetical protein CNBC6470 TREMEDRAFT_34864 similar to predicted protein TREMEDRAFT_65430 predicted protein TREMEDRAFT_34970 similar to hypothetical protein TREMEDRAFT_65432 similar to hypothetical protein CNC00890 TREMEDRAFT_34892 similar to hypothetical protein CNBC0900 TREMEDRAFT_34837 similar to negative regulator of gluconeogenesis TREMEDRAFT_34783 similar to hypothetical protein An12g09830 TREMEDRAFT_34773 similar to hypothetical protein CNBC0920 TREMEDRAFT_72384 similar to hypothetical protein CNBC0840 TREMEDRAFT_70138 similar to hypothetical protein CNBC0820 TREMEDRAFT_17674 similar to hypothetical protein CC1G_03209 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_65446 similar to hypothetical protein CNBC6360 TREMEDRAFT_12085 similar to hypothetical protein CNBC0950 TREMEDRAFT_70146 similar to hypothetical protein CNBK3030 TREMEDRAFT_70147 similar to hypothetical protein CNBC6480 TREMEDRAFT_65452 predicted protein TREMEDRAFT_65453 predicted protein TREMEDRAFT_34839 similar to hypothetical protein CNBC6220 TREMEDRAFT_70154 similar to hypothetical protein CNBC6230 TREMEDRAFT_70155 similar to hypothetical protein CNBC6060 TREMEDRAFT_34976 similar to conserved hypothetical protein TREMEDRAFT_18232 similar to putative ferulate-5-hydroxylase TREMEDRAFT_34845 similar to thioredoxin TREMEDRAFT_65463 similar to hypothetical protein CNBC6070 TREMEDRAFT_65464 predicted protein TREMEDRAFT_70156 similar to hypothetical protein CNBF1830 TREMEDRAFT_65467 predicted protein TREMEDRAFT_65469 predicted protein TREMEDRAFT_65470 predicted protein TREMEDRAFT_65471 similar to M protein TREMEDRAFT_65473 predicted protein TREMEDRAFT_65474 predicted protein TREMEDRAFT_65475 predicted protein TREMEDRAFT_35014 similar to pseudouridylate synthase 4, putative TREMEDRAFT_70159 similar to hypothetical protein CNC01240 TREMEDRAFT_70160 similar to Rossman fold oxidoreductase, putative TREMEDRAFT_65479 predicted protein TREMEDRAFT_74756 similar to Structure Of The H3-H4 Chaperone Asf1 Bound To Histones H3 And H4; expressed hypothetical protein TREMEDRAFT_34792 similar to hypothetical protein CNBC5640 TREMEDRAFT_34906 similar to hypothetical protein CNBC5630 TREMEDRAFT_34776 similar to peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase, putative TREMEDRAFT_35004 similar to hypothetical protein CNC01600 TREMEDRAFT_45730 similar to hypothetical protein FG08777.1; expressed hypothetical protein TREMEDRAFT_65488 similar to hypothetical protein CNBC5780 TREMEDRAFT_65489 similar to hypothetical protein CNC01090 TREMEDRAFT_45737 similar to sterol C-24 reductase TREMEDRAFT_15956 similar to hypothetical protein CNBL2760 TREMEDRAFT_34766 similar to conserved hypothetical protein TREMEDRAFT_45742 similar to hypothetical protein CNBL2730 TREMEDRAFT_65494 similar to hypothetical protein CNBL2720 TREMEDRAFT_65495 similar to hCG1793893 TREMEDRAFT_65496 predicted protein TREMEDRAFT_65497 predicted protein TREMEDRAFT_65498 predicted protein TREMEDRAFT_34957 similar to ubiquinol-cytochrome c reductase complex 7.3 kda protein, putative TREMEDRAFT_19129 similar to 50s ribosomal protein l19, putative TREMEDRAFT_74767 similar to hypothetical protein CNBL2820 TREMEDRAFT_65505 similar to hypothetical protein, partial TREMEDRAFT_57776 expressed protein TREMEDRAFT_34871 similar to hypothetical protein CNBC5960 TREMEDRAFT_65508 predicted protein TREMEDRAFT_65509 similar to hypothetical protein CNBF1830 TREMEDRAFT_65511 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65513 predicted protein TREMEDRAFT_65514 predicted protein TREMEDRAFT_65516 predicted protein TREMEDRAFT_35271 similar to hypothetical protein CNBN0200 TREMEDRAFT_35200 similar to hypothetical protein CNBC5240 TREMEDRAFT_16816 similar to cytoplasm protein, putative TREMEDRAFT_65520 similar to hypothetical protein CNC03190 TREMEDRAFT_35235 similar to hypothetical protein CNBC4030 TREMEDRAFT_35209 similar to hypothetical protein CNBC4040 TREMEDRAFT_72406 similar to hypothetical protein UM05202.1; expressed hypothetical protein TREMEDRAFT_65525 similar to COG1225: Peroxiredoxin TREMEDRAFT_65527 predicted protein TREMEDRAFT_65528 similar to hypothetical protein CNM00870 TREMEDRAFT_70186 similar to hypothetical protein CNM00340 TREMEDRAFT_35179 similar to hypothetical protein CNBM0330 TREMEDRAFT_70187 similar to hypothetical protein CNBM0320 TREMEDRAFT_35099 similar to hypothetical protein CNBM0870 TREMEDRAFT_74773 expressed protein TREMEDRAFT_35119 similar to conserved hypothetical protein TREMEDRAFT_45759 similar to phospholipase B; expressed hypothetical protein TREMEDRAFT_35117 similar to hypothetical protein CNBC4310 TREMEDRAFT_65537 similar to hypothetical protein CNBC4300 TREMEDRAFT_70194 similar to hypothetical protein CNBA5690 TREMEDRAFT_65540 similar to hypothetical protein CNBA5680 TREMEDRAFT_35141 similar to predicted protein TREMEDRAFT_35180 Putative CPD photolyase TREMEDRAFT_65543 similar to hypothetical protein CNBB1670 TREMEDRAFT_70200 similar to hypothetical protein CNBB1680 TREMEDRAFT_70202 similar to hypothetical protein CNBB1720 TREMEDRAFT_45770 similar to hypothetical protein CNBB1620 TREMEDRAFT_70205 similar to conserved hypothetical protein TREMEDRAFT_35311 similar to WD-repeat protein, putative TREMEDRAFT_65551 similar to AE016780 membrane protein, putative, putative TREMEDRAFT_35111 similar to hypothetical protein CNB04010 TREMEDRAFT_65554 predicted protein TREMEDRAFT_65555 predicted protein TREMEDRAFT_65556 predicted protein TREMEDRAFT_65557 similar to hypothetical protein CNBB1790 TREMEDRAFT_65558 similar to hypothetical protein CNBB1800 TREMEDRAFT_45779 similar to hypothetical protein CNBB1820 TREMEDRAFT_65561 predicted protein TREMEDRAFT_65562 predicted protein TREMEDRAFT_35234 similar to predicted protein [Coprinopsis cinerea okayama7#130] TREMEDRAFT_35270 similar to GDP-fucose transporter-like protein TREMEDRAFT_65566 similar to hypothetical protein CNBA7920 TREMEDRAFT_35204 similar to conserved hypothetical protein TREMEDRAFT_35093 similar to hypothetical protein CNBA7910 TREMEDRAFT_65569 similar to hypothetical protein CNBC5390 TREMEDRAFT_65570 predicted protein TREMEDRAFT_65571 similar to hypothetical protein TREMEDRAFT_35192 similar to hypothetical protein CNBA5620 TREMEDRAFT_65574 predicted protein TREMEDRAFT_40971 similar to rRNA processing-related protein, putative; expressed hypothetical protein TREMEDRAFT_72419 similar to predicted protein [Coprinopsis cinerea okayama7#130]; expressed hypothetical protein TREMEDRAFT_72420 expressed protein TREMEDRAFT_65578 predicted protein TREMEDRAFT_65579 predicted protein TREMEDRAFT_74789 similar to putative translation factor; expressed hypothetical protein TREMEDRAFT_74790 expressed protein TREMEDRAFT_65583 predicted protein TREMEDRAFT_65585 predicted protein TREMEDRAFT_65586 predicted protein TREMEDRAFT_65587 similar to RNA binding protein, putative; expressed hypothetical protein TREMEDRAFT_65588 similar to hypothetical protein TREMEDRAFT_70222 similar to hypothetical protein CNBC3190 TREMEDRAFT_35092 similar to hypothetical protein CNBC3180 TREMEDRAFT_35214 similar to hypothetical protein CNBB0360 TREMEDRAFT_65592 predicted protein TREMEDRAFT_65593 predicted protein TREMEDRAFT_65595 predicted protein TREMEDRAFT_65596 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_45797 similar to ATP-dependent RNA helicase A, putative TREMEDRAFT_35273 similar to hypothetical protein CNBB0180 TREMEDRAFT_45798 similar to dolichyl-diphosphooligosaccharide-protein glycotransferase, putative; expressed hypothetical protein TREMEDRAFT_65601 predicted protein TREMEDRAFT_65602 predicted protein TREMEDRAFT_35088 similar to hypothetical protein CNBC3570 TREMEDRAFT_65604 predicted protein TREMEDRAFT_65606 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65609 predicted protein TREMEDRAFT_65610 predicted protein TREMEDRAFT_65611 predicted protein TREMEDRAFT_65612 predicted protein TREMEDRAFT_40986 similar to hypothetical protein CNBB0250 TREMEDRAFT_74797 similar to dolichol kinase, putative TREMEDRAFT_45806 similar to small nucleolar ribonucleoprotein protein, putative TREMEDRAFT_65616 similar to hypothetical protein CNBB3680 TREMEDRAFT_65617 similar to hypothetical protein CNBB5260 TREMEDRAFT_65618 similar to hypothetical protein CNBB3680 TREMEDRAFT_35212 similar to predicted protein TREMEDRAFT_45810 similar to hypothetical protein CNBK2560 TREMEDRAFT_35288 similar to hypothetical protein CNBB0300 TREMEDRAFT_70231 similar to conserved hypothetical protein TREMEDRAFT_70232 similar to hypothetical protein CNBB0280 TREMEDRAFT_65629 similar to Os04g0353200 TREMEDRAFT_65630 predicted protein TREMEDRAFT_65631 similar to hypothetical protein CNBB0160 TREMEDRAFT_65632 similar to hypothetical protein CNM00400 TREMEDRAFT_70236 similar to 20S proteasome subunit TREMEDRAFT_65637 predicted protein TREMEDRAFT_65638 predicted protein TREMEDRAFT_65640 similar to unnamed protein product TREMEDRAFT_65642 predicted protein TREMEDRAFT_65643 predicted protein TREMEDRAFT_65644 similar to hypothetical protein CNA04900 TREMEDRAFT_65646 predicted protein TREMEDRAFT_65648 predicted protein TREMEDRAFT_65650 predicted protein TREMEDRAFT_65651 predicted protein TREMEDRAFT_35286 similar to predicted protein TREMEDRAFT_65653 similar to predicted protein TREMEDRAFT_45824 similar to proline-tRNA ligase, putative; expressed hypothetical protein TREMEDRAFT_65657 predicted protein TREMEDRAFT_65658 predicted protein TREMEDRAFT_65659 predicted protein TREMEDRAFT_65660 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65662 predicted protein TREMEDRAFT_65663 predicted protein TREMEDRAFT_65664 predicted protein TREMEDRAFT_35072 similar to hypothetical protein CC1G_06971 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_35253 similar to hypothetical protein CNBF2160 TREMEDRAFT_65667 similar to hypothetical protein CNBF2150 TREMEDRAFT_65668 predicted protein TREMEDRAFT_65669 similar to hypothetical protein CNB05670 TREMEDRAFT_65670 predicted protein TREMEDRAFT_65672 predicted protein TREMEDRAFT_65674 predicted protein TREMEDRAFT_65676 predicted protein TREMEDRAFT_35282 similar to predicted protein TREMEDRAFT_35226 similar to thaumatin-like protein TREMEDRAFT_65681 predicted protein TREMEDRAFT_65683 predicted protein TREMEDRAFT_65684 predicted protein TREMEDRAFT_65685 similar to hypothetical protein CNBC1040 TREMEDRAFT_65686 predicted protein TREMEDRAFT_65688 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65689 predicted protein TREMEDRAFT_65690 similar to hypothetical protein TREMEDRAFT_72440 expressed protein TREMEDRAFT_65694 predicted protein TREMEDRAFT_70249 similar to hypothetical protein CNBE0230 TREMEDRAFT_35090 similar to hypothetical protein PICST_50616 TREMEDRAFT_65697 similar to hypothetical protein CNBG1420 TREMEDRAFT_65698 predicted protein TREMEDRAFT_35109 similar to cytoplasm protein, putative TREMEDRAFT_65702 predicted protein TREMEDRAFT_65703 similar to hypothetical protein FG05925.1 TREMEDRAFT_35301 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_65706 predicted protein TREMEDRAFT_65707 predicted protein TREMEDRAFT_74813 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_57816 expressed protein TREMEDRAFT_65713 predicted protein TREMEDRAFT_65714 predicted protein TREMEDRAFT_65716 predicted protein TREMEDRAFT_74816 similar to hypothetical protein CND05170 TREMEDRAFT_65719 predicted protein TREMEDRAFT_70257 similar to hypothetical protein CNL05210 TREMEDRAFT_65721 predicted protein TREMEDRAFT_35345 similar to hypothetical protein CNH03590 TREMEDRAFT_65723 predicted protein TREMEDRAFT_65724 predicted protein TREMEDRAFT_72445 similar to WD-repeat protein, putative TREMEDRAFT_65726 predicted protein TREMEDRAFT_65727 predicted protein TREMEDRAFT_65729 predicted protein TREMEDRAFT_65730 similar to hypothetical protein CC1G_13158 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_65732 predicted protein TREMEDRAFT_65733 predicted protein TREMEDRAFT_72446 expressed protein TREMEDRAFT_65734 similar to conserved hypothetical protein TREMEDRAFT_74818 similar to Chitin synthase 1 (Chitin-UDP acetyl-glucosaminyl transferase 1) (Class-IV chitin synthase 1) TREMEDRAFT_65736 predicted protein TREMEDRAFT_65738 predicted protein TREMEDRAFT_65739 predicted protein TREMEDRAFT_65741 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65742 predicted protein TREMEDRAFT_35340 similar to hypothetical protein CNBL1000 TREMEDRAFT_65744 similar to hypothetical protein L8106_03007 TREMEDRAFT_70264 similar to hypothetical protein CNBD6150 TREMEDRAFT_19679 predicted protein TREMEDRAFT_74819 similar to conserved hypothetical protein TREMEDRAFT_65748 predicted protein TREMEDRAFT_65750 predicted protein TREMEDRAFT_65751 predicted protein TREMEDRAFT_65752 predicted protein TREMEDRAFT_65753 predicted protein TREMEDRAFT_57824 expressed protein TREMEDRAFT_74821 similar to hypothetical protein TREMEDRAFT_65756 predicted protein TREMEDRAFT_65758 predicted protein TREMEDRAFT_65759 predicted protein TREMEDRAFT_65762 similar to gag TREMEDRAFT_65763 predicted protein TREMEDRAFT_65766 predicted protein TREMEDRAFT_35357 similar to conserved hypothetical protein TREMEDRAFT_65768 predicted protein TREMEDRAFT_65770 similar to hypothetical protein CNBL0970 TREMEDRAFT_65771 predicted protein TREMEDRAFT_35394 similar to hypothetical protein CNBF1830 TREMEDRAFT_65773 predicted protein TREMEDRAFT_45849 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_65775 predicted protein TREMEDRAFT_65776 predicted protein TREMEDRAFT_65778 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65779 predicted protein TREMEDRAFT_65780 predicted protein TREMEDRAFT_65781 predicted protein TREMEDRAFT_65782 predicted protein TREMEDRAFT_70270 similar to hypothetical protein CNBL1200 TREMEDRAFT_70272 similar to hypothetical protein CNBL1010 TREMEDRAFT_35338 similar to hypothetical protein CNBL1270 TREMEDRAFT_65787 predicted protein TREMEDRAFT_65789 predicted protein TREMEDRAFT_65790 predicted protein TREMEDRAFT_65792 predicted protein TREMEDRAFT_65793 predicted protein TREMEDRAFT_65795 predicted protein TREMEDRAFT_65796 predicted protein TREMEDRAFT_65797 predicted protein TREMEDRAFT_65798 predicted protein TREMEDRAFT_70276 similar to hypothetical protein CNBC0280 TREMEDRAFT_65800 similar to hypothetical protein CNBC0290 TREMEDRAFT_41045 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_65802 similar to hypothetical protein CNBC0180 TREMEDRAFT_13077 similar to hypothetical protein CNBC0180 TREMEDRAFT_35429 similar to hypothetical protein CNBC0190 TREMEDRAFT_65805 predicted protein TREMEDRAFT_65806 predicted protein TREMEDRAFT_65807 predicted protein TREMEDRAFT_65809 predicted protein TREMEDRAFT_21181 similar to hypothetical protein CNBC0220 TREMEDRAFT_74827 similar to hypothetical protein CNC06960 TREMEDRAFT_65813 similar to hypothetical protein CNBL1020 TREMEDRAFT_70282 similar to possible dipeptidase TREMEDRAFT_65817 similar to alpha/beta hydrolase fold TREMEDRAFT_65818 similar to hypothetical protein UM00196.1 TREMEDRAFT_65819 predicted protein TREMEDRAFT_65820 predicted protein TREMEDRAFT_65821 predicted protein TREMEDRAFT_65822 predicted protein TREMEDRAFT_65824 predicted protein TREMEDRAFT_65825 predicted protein TREMEDRAFT_65826 predicted protein TREMEDRAFT_65830 predicted protein TREMEDRAFT_65831 predicted protein TREMEDRAFT_65832 predicted protein TREMEDRAFT_65833 predicted protein TREMEDRAFT_74830 predicted protein TREMEDRAFT_45866 similar to hypothetical protein CNBC0410 TREMEDRAFT_65836 similar to hypothetical protein UM00262.1 TREMEDRAFT_35402 similar to hypothetical protein MGG_05828 TREMEDRAFT_35412 similar to putative polysaccharide deacetylase family protein TREMEDRAFT_65839 predicted protein TREMEDRAFT_65840 predicted protein TREMEDRAFT_65841 similar to hypothetical protein TREMEDRAFT_35330 similar to hypothetical protein CNBE0610 TREMEDRAFT_74832 similar to protein binding protein, putative TREMEDRAFT_65844 predicted protein TREMEDRAFT_65845 predicted protein TREMEDRAFT_65846 predicted protein TREMEDRAFT_65847 predicted protein TREMEDRAFT_23302 similar to predicted protein TREMEDRAFT_57834 expressed protein TREMEDRAFT_65851 predicted protein TREMEDRAFT_35494 similar to hypothetical protein CNBL2500 TREMEDRAFT_70294 similar to hypothetical protein CNBF3190 TREMEDRAFT_74835 similar to hypothetical protein CNBF3260 TREMEDRAFT_74837 similar to hypothetical protein CNBF3170 TREMEDRAFT_74838 predicted protein TREMEDRAFT_35450 similar to hypothetical protein TREMEDRAFT_57837 expressed protein TREMEDRAFT_41072 similar to importin beta-4 subunit, putative; expressed hypothetical protein TREMEDRAFT_65863 similar to hypothetical protein CNBF3900 TREMEDRAFT_70300 similar to hypothetical protein CNBF3860 TREMEDRAFT_65866 predicted protein TREMEDRAFT_65867 predicted protein TREMEDRAFT_65868 predicted protein TREMEDRAFT_65870 predicted protein TREMEDRAFT_65871 predicted protein TREMEDRAFT_65872 predicted protein TREMEDRAFT_65874 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65875 similar to cytoplasm protein, putative TREMEDRAFT_35522 similar to conserved hypothetical protein TREMEDRAFT_41081 similar to transparent testa glabra 1 protein (ttg1 protein), putative; expressed hypothetical protein TREMEDRAFT_35470 similar to MCM complex subunit Mcm7 TREMEDRAFT_65879 similar to hypothetical protein CNI02530 TREMEDRAFT_65880 similar to hypothetical protein LELG_02571 TREMEDRAFT_65882 predicted protein TREMEDRAFT_65883 predicted protein TREMEDRAFT_35438 similar to conserved hypothetical protein TREMEDRAFT_70308 similar to hypothetical protein CNBF3790 TREMEDRAFT_35473 similar to predicted protein TREMEDRAFT_65889 predicted protein TREMEDRAFT_35527 similar to dynein heavy chain protein 1 TREMEDRAFT_65892 similar to hypothetical protein UM00335.1 TREMEDRAFT_72470 similar to DNA-directed RNA polymerase iii largest subunit, putative TREMEDRAFT_45892 similar to UMP-CMP kinase, putative; expressed hypothetical protein TREMEDRAFT_35613 similar to hypothetical protein CNBF4280 TREMEDRAFT_65896 predicted protein TREMEDRAFT_65897 similar to receptor accessory protein 6, isoform CRA_b TREMEDRAFT_65898 predicted protein TREMEDRAFT_65899 predicted protein TREMEDRAFT_41093 similar to nuclear mRNA splicing protein TREMEDRAFT_45902 similar to glutamate-tRNA ligase, putative; expressed hypothetical protein TREMEDRAFT_65902 predicted protein TREMEDRAFT_65903 predicted protein TREMEDRAFT_35623 similar to hypothetical protein UM04712.1 TREMEDRAFT_70320 similar to copper transporter; expressed hypothetical protein TREMEDRAFT_65909 similar to Topoisomerase 1-associated factor 1 TREMEDRAFT_70321 similar to 3' TREMEDRAFT_70323 similar to hypothetical protein CNBG0760 TREMEDRAFT_65912 similar to hCG2042888, isoform CRA_a TREMEDRAFT_65913 similar to hypothetical protein CNBF4540 TREMEDRAFT_72477 similar to hypothetical protein CNBF4620 TREMEDRAFT_35609 similar to membrane protein, putative TREMEDRAFT_35565 similar to hypothetical protein CNBF4410 TREMEDRAFT_65917 predicted protein TREMEDRAFT_65919 predicted protein TREMEDRAFT_35495 similar to hypothetical protein CHGG_05730 TREMEDRAFT_45917 similar to phosphoglycerate dehydrogenase, putative; expressed hypothetical protein TREMEDRAFT_65925 similar to hypothetical protein TREMEDRAFT_35601 similar to hypothetical protein CNBF4570 TREMEDRAFT_65927 similar to hypothetical protein TREMEDRAFT_65929 similar to hypothetical protein CNF00480 TREMEDRAFT_35559 similar to hypothetical protein TREMEDRAFT_35498 similar to transcription factor iiib 70 kd subunit, putative TREMEDRAFT_15209 similar to diacylglycerol O-acyltransferase, putative TREMEDRAFT_35563 similar to hypothetical protein CNBF4350 TREMEDRAFT_65936 similar to hypothetical protein CNBC1040 TREMEDRAFT_70333 similar to hypothetical protein CNBF2260 TREMEDRAFT_65938 similar to hypothetical protein CNBF4200 TREMEDRAFT_65940 similar to conserved hypothetical protein TREMEDRAFT_65942 predicted protein TREMEDRAFT_65944 similar to hypothetical protein CIMG_04839 TREMEDRAFT_65945 predicted protein TREMEDRAFT_65946 predicted protein TREMEDRAFT_45932 similar to late endosome to vacuole transport-related protein, putative; expressed hypothetical protein TREMEDRAFT_65948 predicted protein TREMEDRAFT_35617 similar to hypothetical protein CC1G_00833 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_70338 similar to conserved hypothetical protein TREMEDRAFT_65953 similar to hypothetical protein FG03454.1 TREMEDRAFT_35553 similar to hypothetical protein TREMEDRAFT_74868 similar to Bromodomain and PHD finger-containing protein 3, putative TREMEDRAFT_74869 similar to hypothetical protein CNF02290 TREMEDRAFT_35580 similar to hypothetical protein CNBF2440 TREMEDRAFT_65960 similar to kinesin, putative TREMEDRAFT_65962 predicted protein TREMEDRAFT_65963 predicted protein TREMEDRAFT_65964 predicted protein TREMEDRAFT_57868 expressed protein TREMEDRAFT_57869 expressed protein TREMEDRAFT_72489 expressed protein TREMEDRAFT_57870 expressed protein TREMEDRAFT_65968 predicted protein TREMEDRAFT_65971 similar to predicted protein TREMEDRAFT_45943 similar to Putative dehydrogenase, D-3- phosphoglycerate dehydrogenase-like protein; expressed hypothetical protein TREMEDRAFT_45944 similar to transporter, putative; expressed hypothetical protein TREMEDRAFT_72491 expressed protein TREMEDRAFT_65976 similar to hypothetical protein TREMEDRAFT_65977 similar to hypothetical protein CNBH0730 TREMEDRAFT_70349 similar to hypothetical protein TREMEDRAFT_65979 predicted protein TREMEDRAFT_65980 predicted protein TREMEDRAFT_65981 similar to hypothetical protein CNBH0710 TREMEDRAFT_70350 similar to conserved hypothetical protein TREMEDRAFT_65984 similar to hypothetical protein CNBH0910 TREMEDRAFT_65985 similar to predicted protein TREMEDRAFT_22085 similar to hypothetical protein CNBH0900 TREMEDRAFT_35661 similar to conserved hypothetical protein TREMEDRAFT_65988 similar to conserved hypothetical protein TREMEDRAFT_35695 similar to hypothetical protein CNBH0890 TREMEDRAFT_70352 similar to hypothetical protein CNBH0970 TREMEDRAFT_35639 similar to conserved hypothetical protein TREMEDRAFT_65993 predicted protein TREMEDRAFT_65994 predicted protein TREMEDRAFT_65995 similar to extraembryonic spermatogenesis homeobox 1-like protein TREMEDRAFT_65996 predicted protein TREMEDRAFT_70354 similar to hypothetical protein CNBI2300 TREMEDRAFT_65999 predicted protein TREMEDRAFT_66000 predicted protein TREMEDRAFT_66002 similar to hypothetical protein CNL05280 TREMEDRAFT_74881 similar to hypothetical protein UM00406.1; expressed hypothetical protein TREMEDRAFT_66004 predicted protein TREMEDRAFT_66005 similar to hypothetical protein CNBI2280 TREMEDRAFT_35707 similar to hypothetical protein CNBH1000 TREMEDRAFT_22906 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_35762 similar to hypothetical protein CNBI1400 TREMEDRAFT_66009 predicted protein TREMEDRAFT_72495 similar to DNA helicase, putative; expressed hypothetical protein TREMEDRAFT_66011 predicted protein TREMEDRAFT_66012 predicted protein TREMEDRAFT_66013 predicted protein TREMEDRAFT_35660 similar to hypothetical protein CNBI1370 TREMEDRAFT_35632 similar to conserved hypothetical protein TREMEDRAFT_70362 similar to peptidase, putative TREMEDRAFT_35751 similar to low-affinity phosphodiesterase TREMEDRAFT_66018 predicted protein TREMEDRAFT_66019 predicted protein TREMEDRAFT_66020 similar to hypothetical protein CIMG_04839 TREMEDRAFT_66022 predicted protein TREMEDRAFT_66025 predicted protein TREMEDRAFT_66026 predicted protein TREMEDRAFT_45959 similar to alanine-glyoxylate transaminase, putative; expressed hypothetical protein TREMEDRAFT_35753 similar to hypothetical protein CNBI1480 TREMEDRAFT_70368 similar to mitochondrion protein, putative TREMEDRAFT_35671 similar to hypothetical protein CNBH0090 TREMEDRAFT_35758 similar to hypothetical protein CNBH0090 TREMEDRAFT_66032 predicted protein TREMEDRAFT_66034 predicted protein TREMEDRAFT_66036 similar to hypothetical protein CNBD5750 TREMEDRAFT_66037 predicted protein TREMEDRAFT_35701 similar to hypothetical protein CNBD5910 TREMEDRAFT_66042 similar to hypothetical protein CIMG_04839 TREMEDRAFT_66044 predicted protein TREMEDRAFT_70373 similar to acetamidase (predicted) TREMEDRAFT_35703 similar to conserved hypothetical protein TREMEDRAFT_21230 similar to alkylbase DNA N-glycosylase, putative TREMEDRAFT_66047 predicted protein TREMEDRAFT_66049 predicted protein TREMEDRAFT_66050 predicted protein TREMEDRAFT_74889 similar to predicted protein TREMEDRAFT_35686 similar to pseudouridylate synthase, putative TREMEDRAFT_70376 similar to hypothetical protein TREMEDRAFT_35766 similar to hypothetical protein CNBC2330 TREMEDRAFT_11865 similar to hypothetical protein CNBH0610 TREMEDRAFT_70378 similar to GPI-anchor transamidase, putative TREMEDRAFT_66057 similar to predicted protein TREMEDRAFT_66058 predicted protein TREMEDRAFT_66059 predicted protein TREMEDRAFT_66060 similar to predicted protein TREMEDRAFT_70381 similar to hypothetical protein CC1G_00814 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_19626 similar to hypothetical protein CNBH0630 TREMEDRAFT_66064 predicted protein TREMEDRAFT_66065 predicted protein TREMEDRAFT_70382 similar to hypothetical protein CNBC3110 TREMEDRAFT_66067 predicted protein TREMEDRAFT_66068 predicted protein TREMEDRAFT_70383 similar to hypothetical protein CNBH0240 TREMEDRAFT_66071 predicted protein TREMEDRAFT_66073 predicted protein TREMEDRAFT_66074 predicted protein TREMEDRAFT_45974 similar to hypothetical protein CNL05370 TREMEDRAFT_66076 predicted protein TREMEDRAFT_72503 similar to hypothetical protein CNBH0310 TREMEDRAFT_66079 predicted protein TREMEDRAFT_66080 predicted protein TREMEDRAFT_66083 predicted protein TREMEDRAFT_35730 similar to predicted protein TREMEDRAFT_66086 predicted protein TREMEDRAFT_66087 predicted protein TREMEDRAFT_66088 predicted protein TREMEDRAFT_66090 predicted protein TREMEDRAFT_45982 similar to small nuclear ribonucleoprotein, putative; expressed hypothetical protein TREMEDRAFT_70391 similar to ribonucleases P/MRP protein subunit, putative TREMEDRAFT_66093 similar to hypothetical protein TREMEDRAFT_66094 predicted protein TREMEDRAFT_35735 similar to Deoxyhypusine hydroxylase (Deoxyhypusine monooxygenase) (DOHH) TREMEDRAFT_41188 similar to Phospholipase A-2-activating protein, putative; expressed hypothetical protein TREMEDRAFT_20822 similar to hypothetical protein CNBI1450 TREMEDRAFT_35664 similar to hypothetical protein CNBD2990 TREMEDRAFT_66099 similar to Rab GTPase activator, putative TREMEDRAFT_35729 similar to cation transporter, putative TREMEDRAFT_66101 predicted protein TREMEDRAFT_19413 similar to hypothetical protein CNBL2490 TREMEDRAFT_66102 similar to hypothetical protein CNBL2480 TREMEDRAFT_15682 similar to hypothetical protein CNBK0370 TREMEDRAFT_66106 predicted protein TREMEDRAFT_74899 similar to hypothetical protein CNBA0450 TREMEDRAFT_70402 similar to hypothetical protein CNA00920 TREMEDRAFT_41207 similar to C-14 sterol reductase, putative; expressed hypothetical protein TREMEDRAFT_35792 similar to hypothetical protein CNBA6080 TREMEDRAFT_66115 similar to hypothetical protein CNBB4530 TREMEDRAFT_41215 similar to D-lactate dehydrogenase cytochrome oxidoreductase protein; expressed hypothetical protein TREMEDRAFT_70409 similar to hypothetical protein CNBB5010 TREMEDRAFT_35861 similar to predicted protein TREMEDRAFT_36003 similar to hypothetical protein CNBI1030 TREMEDRAFT_70412 similar to conserved hypothetical protein TREMEDRAFT_66122 predicted protein TREMEDRAFT_72520 expressed protein TREMEDRAFT_57907 expressed protein TREMEDRAFT_66125 predicted protein TREMEDRAFT_72521 similar to glycerol transporter, putative; expressed hypothetical protein TREMEDRAFT_66127 similar to conserved hypothetical protein TREMEDRAFT_66130 similar to dentin sialophosphoprotein precursor, putative TREMEDRAFT_66131 similar to hypothetical protein TREMEDRAFT_35940 similar to conserved hypothetical protein TREMEDRAFT_57911 expressed protein TREMEDRAFT_35909 similar to hypothetical protein CNBF4430 TREMEDRAFT_70420 similar to conserved hypothetical protein TREMEDRAFT_66137 predicted protein TREMEDRAFT_20234 similar to Gpg2 TREMEDRAFT_35832 similar to hypothetical protein CNBF3930 TREMEDRAFT_46029 similar to p68-like protein, putative; expressed hypothetical protein TREMEDRAFT_70424 similar to hypothetical protein CNBF3410 TREMEDRAFT_41238 similar to rRNA primary transcript binding protein, putative; expressed hypothetical protein TREMEDRAFT_66144 predicted protein TREMEDRAFT_66145 predicted protein TREMEDRAFT_66146 predicted protein TREMEDRAFT_13823 similar to hypothetical protein CNBF3390 TREMEDRAFT_72530 expressed protein TREMEDRAFT_66150 predicted protein TREMEDRAFT_36021 similar to Cytochrome P450, putative TREMEDRAFT_35819 similar to hypothetical protein CNBF3420 TREMEDRAFT_66152 predicted protein TREMEDRAFT_35789 similar to hypothetical protein CNBF3440 TREMEDRAFT_36009 similar to hypothetical protein CNBF2720 TREMEDRAFT_35849 similar to unknown TREMEDRAFT_36027 similar to predicted protein TREMEDRAFT_74919 similar to conserved hypothetical protein TREMEDRAFT_74920 similar to peptide alpha-N-acetyltransferase, putative; expressed hypothetical protein TREMEDRAFT_35867 similar to Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) TREMEDRAFT_70436 similar to hypothetical protein CNBB0740 TREMEDRAFT_70437 similar to hypothetical protein CNBF3280 TREMEDRAFT_36016 similar to hypothetical protein TREMEDRAFT_16632 similar to hypothetical protein CNBF3510 TREMEDRAFT_57919 expressed protein TREMEDRAFT_66164 predicted protein TREMEDRAFT_66165 predicted protein TREMEDRAFT_35988 similar to predicted protein TREMEDRAFT_35823 similar to hypothetical protein CNBF3380 TREMEDRAFT_74924 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_57923 expressed protein TREMEDRAFT_66170 predicted protein TREMEDRAFT_70442 similar to GTPase activating protein, putative TREMEDRAFT_66172 similar to hypothetical protein SS1G_03237 TREMEDRAFT_35995 similar to hypothetical protein CNBE0840 TREMEDRAFT_66174 predicted protein TREMEDRAFT_66175 predicted protein TREMEDRAFT_35889 similar to hypothetical protein CNBF3640 TREMEDRAFT_66178 similar to hypothetical protein CNBF3970 TREMEDRAFT_70445 similar to hypothetical protein CNBF3030 TREMEDRAFT_66180 similar to hypothetical protein CNA08230 TREMEDRAFT_74928 similar to polysaccharide deacetylase TREMEDRAFT_35894 similar to urate catabolism protein TREMEDRAFT_70448 similar to hypothetical protein CNBD3230 TREMEDRAFT_66185 similar to hypothetical protein CNBF3610 TREMEDRAFT_19451 similar to hypothetical protein CNF00930 TREMEDRAFT_72538 similar to potassium:hydrogen antiporter, putative TREMEDRAFT_66191 predicted protein TREMEDRAFT_66193 similar to hypothetical protein CNF01600 TREMEDRAFT_35791 similar to hypothetical protein CNF01140 TREMEDRAFT_35843 similar to hypothetical protein TREMEDRAFT_35912 similar to hypothetical protein CNBF3740 TREMEDRAFT_72540 similar to hypothetical protein CNBF2040 TREMEDRAFT_35925 similar to hypothetical protein CC1G_01263 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_35872 similar to conserved hypothetical protein TREMEDRAFT_66202 similar to hypothetical protein CNBC1040 TREMEDRAFT_66203 predicted protein TREMEDRAFT_46070 similar to hypothetical protein CNBI0260 TREMEDRAFT_66205 similar to hypothetical protein CNBF2020 TREMEDRAFT_66206 predicted protein TREMEDRAFT_66207 similar to hypothetical protein TREMEDRAFT_66208 similar to hypothetical protein CNBF2190 TREMEDRAFT_35860 similar to hypothetical protein CNBF2350 TREMEDRAFT_18648 similar to hypothetical protein CNBF2120 TREMEDRAFT_66212 predicted protein TREMEDRAFT_74941 similar to hypothetical protein CNBF2330 TREMEDRAFT_66215 similar to hypothetical protein CNBF2320 TREMEDRAFT_66216 predicted protein TREMEDRAFT_66217 similar to cell wall organization and biogenesis-related protein, putative TREMEDRAFT_46082 similar to cytoplasm protein, putative TREMEDRAFT_70467 similar to hypothetical protein CNF02490 TREMEDRAFT_70468 similar to hypothetical protein CNF02610 TREMEDRAFT_46085 similar to hypothetical protein CNBF2080 TREMEDRAFT_70470 similar to hypothetical protein CC1G_00208 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_66224 similar to hypothetical protein CNBF2250 TREMEDRAFT_66227 predicted protein TREMEDRAFT_66230 predicted protein TREMEDRAFT_66231 predicted protein TREMEDRAFT_66232 predicted protein TREMEDRAFT_35809 similar to hypothetical protein UM04237.1 TREMEDRAFT_66234 similar to hypothetical protein CC1G_05662 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_35781 similar to hypothetical protein CNBN1350 TREMEDRAFT_46100 similar to hypothetical protein CNBN1360 TREMEDRAFT_66239 predicted protein TREMEDRAFT_66240 predicted protein TREMEDRAFT_66241 similar to hypothetical protein NEMVEDRAFT_v1g152780 TREMEDRAFT_66242 predicted protein TREMEDRAFT_46104 similar to acid phosphatase, orthophosphoric monoester phosphohydrolase, APase {} [Aspergillus ficuum, NRRL 3135, Peptide, 583 aa] TREMEDRAFT_74952 predicted protein TREMEDRAFT_66245 similar to hypothetical protein CNBG1800 TREMEDRAFT_35989 similar to hypothetical protein CNBF2590 TREMEDRAFT_46110 similar to hypothetical protein CNF03180 TREMEDRAFT_66249 predicted protein TREMEDRAFT_46112 similar to hypothetical protein CNBF1610 TREMEDRAFT_66252 similar to conserved hypothetical protein-transmembrane prediction TREMEDRAFT_66253 similar to predicted protein TREMEDRAFT_66255 predicted protein TREMEDRAFT_66256 predicted protein TREMEDRAFT_19040 similar to hypothetical protein CNA05530 TREMEDRAFT_66258 predicted protein TREMEDRAFT_66260 predicted protein TREMEDRAFT_66261 predicted protein TREMEDRAFT_66262 predicted protein TREMEDRAFT_66264 predicted protein TREMEDRAFT_66268 similar to zinc finger, CCHC domain containing 5 TREMEDRAFT_66269 predicted protein TREMEDRAFT_66271 predicted protein TREMEDRAFT_66272 predicted protein TREMEDRAFT_57956 expressed protein TREMEDRAFT_66274 predicted protein TREMEDRAFT_66275 similar to hypothetical protein CNBI2320 TREMEDRAFT_66276 predicted protein TREMEDRAFT_66277 similar to rCG42783 TREMEDRAFT_66278 predicted protein TREMEDRAFT_57957 similar to MYO5C protein; expressed hypothetical protein TREMEDRAFT_72561 expressed protein TREMEDRAFT_66280 predicted protein TREMEDRAFT_66281 predicted protein TREMEDRAFT_66282 similar to hypothetical protein BC1G_15283 TREMEDRAFT_66286 predicted protein TREMEDRAFT_66288 predicted protein TREMEDRAFT_66290 predicted protein TREMEDRAFT_66291 predicted protein TREMEDRAFT_66292 predicted protein TREMEDRAFT_66293 predicted protein TREMEDRAFT_66295 predicted protein TREMEDRAFT_66296 predicted protein TREMEDRAFT_66297 similar to unnamed protein product TREMEDRAFT_72562 expressed protein TREMEDRAFT_57960 similar to hCG2042559; expressed hypothetical protein TREMEDRAFT_57962 predicted protein TREMEDRAFT_57961 expressed protein TREMEDRAFT_57963 expressed protein TREMEDRAFT_66301 predicted protein TREMEDRAFT_57964 expressed protein TREMEDRAFT_74963 predicted protein TREMEDRAFT_66304 predicted protein TREMEDRAFT_66305 predicted protein TREMEDRAFT_74964 expressed protein TREMEDRAFT_66307 predicted protein TREMEDRAFT_66308 predicted protein TREMEDRAFT_57965 expressed protein TREMEDRAFT_66310 predicted protein TREMEDRAFT_66311 similar to SNF2 domain/helicase domain/RING finger domain-containing protein TREMEDRAFT_66312 predicted protein TREMEDRAFT_66313 predicted protein TREMEDRAFT_66314 predicted protein TREMEDRAFT_66316 predicted protein TREMEDRAFT_66317 predicted protein TREMEDRAFT_66318 predicted protein TREMEDRAFT_66319 predicted protein TREMEDRAFT_66321 predicted protein TREMEDRAFT_66324 predicted protein TREMEDRAFT_66325 predicted protein TREMEDRAFT_66330 predicted protein TREMEDRAFT_66331 similar to hypothetical protein CC1G_01090 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_66332 predicted protein TREMEDRAFT_66333 predicted protein TREMEDRAFT_66334 predicted protein TREMEDRAFT_66335 predicted protein TREMEDRAFT_66336 predicted protein TREMEDRAFT_66338 predicted protein TREMEDRAFT_66339 predicted protein TREMEDRAFT_66340 predicted protein TREMEDRAFT_66341 predicted protein TREMEDRAFT_66343 predicted protein TREMEDRAFT_70500 similar to ferredoxin; expressed hypothetical protein TREMEDRAFT_36131 similar to hypothetical protein CNBG4700 TREMEDRAFT_66347 predicted protein TREMEDRAFT_66348 predicted protein TREMEDRAFT_66350 similar to hypothetical protein CNBC1040 TREMEDRAFT_66351 similar to unknown TREMEDRAFT_36119 similar to hCG1990054 TREMEDRAFT_66353 predicted protein TREMEDRAFT_66354 predicted protein TREMEDRAFT_36090 similar to SP85 TREMEDRAFT_66355 similar to TPA_exp: transposase TREMEDRAFT_66357 predicted protein TREMEDRAFT_66358 predicted protein TREMEDRAFT_66359 predicted protein TREMEDRAFT_66360 predicted protein TREMEDRAFT_57970 expressed protein TREMEDRAFT_66363 predicted protein TREMEDRAFT_66365 predicted protein TREMEDRAFT_66366 predicted protein TREMEDRAFT_66367 predicted protein TREMEDRAFT_66368 predicted protein TREMEDRAFT_66369 predicted protein TREMEDRAFT_66370 predicted protein TREMEDRAFT_66371 similar to hypothetical protein CIMG_04839 TREMEDRAFT_66373 predicted protein TREMEDRAFT_66375 predicted protein TREMEDRAFT_36141 similar to conserved hypothetical protein TREMEDRAFT_70510 similar to hypothetical protein CNBG4500 TREMEDRAFT_66378 similar to hypothetical protein TREMEDRAFT_66379 predicted protein TREMEDRAFT_66380 predicted protein TREMEDRAFT_66382 similar to hypothetical protein GobsU_11050 TREMEDRAFT_66384 similar to hypothetical protein CNJ00190 TREMEDRAFT_74972 similar to hypothetical protein CNB00460 TREMEDRAFT_74973 similar to hypothetical protein CNJ03030 TREMEDRAFT_70514 similar to sulfide:quinone oxidoreductase mitochondrial precursor; expressed hypothetical protein TREMEDRAFT_66388 predicted protein TREMEDRAFT_66390 predicted protein TREMEDRAFT_66391 predicted protein TREMEDRAFT_66393 predicted protein TREMEDRAFT_66394 predicted protein TREMEDRAFT_66395 similar to hypothetical protein CNBK0180 TREMEDRAFT_66396 predicted protein TREMEDRAFT_66397 predicted protein TREMEDRAFT_72573 expressed protein TREMEDRAFT_66399 predicted protein TREMEDRAFT_36149 similar to Structure Of The Chromatin Binding (Chromo) Domain From Mouse Modifier Protein 1, Nmr, 26 Structures TREMEDRAFT_66402 predicted protein TREMEDRAFT_66403 predicted protein TREMEDRAFT_66404 predicted protein TREMEDRAFT_66405 predicted protein TREMEDRAFT_66406 predicted protein TREMEDRAFT_57975 predicted protein TREMEDRAFT_66411 predicted protein TREMEDRAFT_66413 predicted protein TREMEDRAFT_72575 expressed protein TREMEDRAFT_57979 expressed protein TREMEDRAFT_66415 predicted protein TREMEDRAFT_66416 predicted protein TREMEDRAFT_57980 expressed protein TREMEDRAFT_66418 predicted protein TREMEDRAFT_36150 similar to putative CENP-B/ARS binding protein-like protein TREMEDRAFT_66420 predicted protein TREMEDRAFT_66421 predicted protein TREMEDRAFT_66422 predicted protein TREMEDRAFT_66423 predicted protein TREMEDRAFT_66424 predicted protein TREMEDRAFT_66425 predicted protein TREMEDRAFT_66426 predicted protein TREMEDRAFT_66427 predicted protein TREMEDRAFT_66428 predicted protein TREMEDRAFT_66430 predicted protein TREMEDRAFT_70521 predicted protein TREMEDRAFT_66431 similar to peptidase M23B TREMEDRAFT_66432 predicted protein TREMEDRAFT_66433 predicted protein TREMEDRAFT_66434 predicted protein TREMEDRAFT_66435 similar to predicted protein TREMEDRAFT_66436 similar to predicted protein TREMEDRAFT_66437 predicted protein TREMEDRAFT_66438 predicted protein TREMEDRAFT_66439 predicted protein TREMEDRAFT_36159 similar to putative CENP-B/ARS binding protein-like protein TREMEDRAFT_74978 predicted protein TREMEDRAFT_66443 predicted protein TREMEDRAFT_66444 predicted protein TREMEDRAFT_66445 predicted protein TREMEDRAFT_72576 expressed protein TREMEDRAFT_57981 expressed protein TREMEDRAFT_57982 predicted protein TREMEDRAFT_66450 predicted protein TREMEDRAFT_66451 predicted protein TREMEDRAFT_66452 predicted protein TREMEDRAFT_66454 similar to hypothetical protein CC1G_12531 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_66455 similar to hypothetical protein HCAG_09135 TREMEDRAFT_72577 expressed protein TREMEDRAFT_57984 expressed protein TREMEDRAFT_66458 predicted protein TREMEDRAFT_66459 predicted protein TREMEDRAFT_66460 predicted protein TREMEDRAFT_66461 predicted protein TREMEDRAFT_66462 similar to CG4557-PA TREMEDRAFT_66463 predicted protein TREMEDRAFT_66464 predicted protein TREMEDRAFT_66465 predicted protein TREMEDRAFT_66466 predicted protein TREMEDRAFT_66467 predicted protein TREMEDRAFT_66468 predicted protein TREMEDRAFT_66470 predicted protein TREMEDRAFT_66471 predicted protein TREMEDRAFT_66472 predicted protein TREMEDRAFT_66473 predicted protein TREMEDRAFT_74982 predicted protein TREMEDRAFT_66475 predicted protein TREMEDRAFT_57985 similar to predicted protein; expressed hypothetical protein TREMEDRAFT_57986 expressed protein TREMEDRAFT_66477 predicted protein TREMEDRAFT_66478 predicted protein TREMEDRAFT_66479 predicted protein TREMEDRAFT_66480 similar to hypothetical protein CIMG_04839 TREMEDRAFT_66481 predicted protein TREMEDRAFT_66482 predicted protein TREMEDRAFT_66483 predicted protein TREMEDRAFT_66484 predicted protein TREMEDRAFT_66485 predicted protein TREMEDRAFT_66486 predicted protein TREMEDRAFT_66487 predicted protein TREMEDRAFT_66489 predicted protein TREMEDRAFT_66490 predicted protein TREMEDRAFT_72578 expressed protein TREMEDRAFT_66492 similar to Putative uncharacterized protein YHR217C TREMEDRAFT_66493 predicted protein TREMEDRAFT_66494 predicted protein TREMEDRAFT_66495 predicted protein TREMEDRAFT_66496 predicted protein TREMEDRAFT_66497 predicted protein TREMEDRAFT_66498 predicted protein TREMEDRAFT_57989 expressed protein TREMEDRAFT_66499 predicted protein TREMEDRAFT_66500 predicted protein TREMEDRAFT_66501 similar to hypothetical protein CNBF1830 TREMEDRAFT_36178 similar to hypothetical protein CNBF1830 TREMEDRAFT_66503 similar to hypothetical protein TREMEDRAFT_66504 predicted protein TREMEDRAFT_57990 predicted protein TREMEDRAFT_66508 similar to Os08g0300100 TREMEDRAFT_66510 predicted protein TREMEDRAFT_57991 expressed protein TREMEDRAFT_66512 predicted protein TREMEDRAFT_66516 predicted protein TREMEDRAFT_66517 predicted protein TREMEDRAFT_74987 predicted protein TREMEDRAFT_57992 expressed protein TREMEDRAFT_66519 predicted protein TREMEDRAFT_66520 predicted protein TREMEDRAFT_66521 predicted protein TREMEDRAFT_36230 similar to hypothetical protein CNBD5340 TREMEDRAFT_70540 similar to Aromatic-L-amino-acid decarboxylase, putative TREMEDRAFT_46147 similar to mitochondrion protein, putative; expressed hypothetical protein TREMEDRAFT_70543 similar to hypothetical protein CNBD5390 TREMEDRAFT_74991 similar to hypothetical protein CNL05700 TREMEDRAFT_36232 similar to predicted protein TREMEDRAFT_66530 predicted protein TREMEDRAFT_66536 similar to hypothetical protein CNBE4050 TREMEDRAFT_66537 predicted protein TREMEDRAFT_36218 similar to hypothetical protein CNBD5300 TREMEDRAFT_74998 predicted protein TREMEDRAFT_66542 predicted protein TREMEDRAFT_70556 similar to carbonic anhydrase 1 TREMEDRAFT_36250 similar to hypothetical protein CNBH3120 TREMEDRAFT_36224 similar to hypothetical protein UM04410.1 TREMEDRAFT_13495 similar to aflatoxin efflux pump AFLT, putative TREMEDRAFT_46166 similar to hypothetical protein CNBD5990 TREMEDRAFT_70561 similar to hypothetical protein CNBD5170 TREMEDRAFT_36246 similar to hypothetical protein CNBD5160 TREMEDRAFT_66553 predicted protein TREMEDRAFT_66554 predicted protein TREMEDRAFT_66555 predicted protein TREMEDRAFT_66558 predicted protein TREMEDRAFT_66560 predicted protein TREMEDRAFT_66563 predicted protein TREMEDRAFT_66565 predicted protein TREMEDRAFT_66566 predicted protein TREMEDRAFT_66568 predicted protein TREMEDRAFT_36295 similar to hypothetical protein SS1G_12403 TREMEDRAFT_36276 similar to hypothetical protein CNBE5140 TREMEDRAFT_70570 expressed protein TREMEDRAFT_66575 predicted protein TREMEDRAFT_75005 similar to hypothetical protein CNBD1100 TREMEDRAFT_36275 similar to hypothetical protein CNBM0500 TREMEDRAFT_66578 predicted protein TREMEDRAFT_66579 predicted protein TREMEDRAFT_13319 similar to hypothetical protein CNM00670 TREMEDRAFT_66581 predicted protein TREMEDRAFT_66583 predicted protein TREMEDRAFT_66584 predicted protein TREMEDRAFT_72598 similar to hypothetical protein CNBC4000 TREMEDRAFT_36273 similar to predicted protein TREMEDRAFT_46183 similar to hypothetical protein CNBM0590 TREMEDRAFT_70580 similar to hypothetical protein CNBC5230 TREMEDRAFT_66591 predicted protein TREMEDRAFT_66592 predicted protein TREMEDRAFT_66593 similar to hypothetical protein TREMEDRAFT_17489 similar to hypothetical protein CC1G_00341 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_66595 predicted protein TREMEDRAFT_66596 predicted protein TREMEDRAFT_66597 predicted protein TREMEDRAFT_66598 predicted protein TREMEDRAFT_66599 predicted protein TREMEDRAFT_66600 predicted protein TREMEDRAFT_46186 similar to hypothetical protein CNBN1610 TREMEDRAFT_66605 predicted protein TREMEDRAFT_36310 similar to hypothetical protein An17g00100 TREMEDRAFT_66607 predicted protein TREMEDRAFT_66608 similar to TPA: pol-like protein TREMEDRAFT_66609 similar to hypothetical protein CNBC6030 TREMEDRAFT_36313 similar to hypothetical protein CNC00410 TREMEDRAFT_66611 predicted protein TREMEDRAFT_66612 predicted protein TREMEDRAFT_66613 predicted protein TREMEDRAFT_66615 predicted protein TREMEDRAFT_66617 similar to hypothetical protein CC1G_12633 [Coprinopsis cinerea okayama7#130] TREMEDRAFT_66618 predicted protein TREMEDRAFT_66619 similar to hypothetical protein CNBG1430